KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0583Help
Entry
Pse7367_0583      CDS       T02369                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pseu00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748220..749779
Genome map
AA seq 519 aa AA seqDB search
MTSGKVYIVGAGVGGIDYLTVKAQRLISQAEAIVYDALIDESLLALTPVSCDRHYVGKRG
GQLSIKQPEINNLLVKLCQQGKQVVRLKSGDPFIFGRAVPELEALRANNCEYEIVPGISS
AIAASLFSGIPLTDAKLSPCFAVLTAHDLENLPWPALAEIPTLAILMGTRGLQGENPPLL
AKLRQGKSADTPIAVVQWCGSHAPEQQQKIWLGTLTDIQSKLPDYALSPAVILVGEVVRY
HDRLSWFRPGQMERHNKALTGITVMVTRATGQSSQFSQMLIDTGARVVEMPTLAILPPDS
WADLDRAIANLDRYDWLILTSANGVYSFFERLHHAQKDSRALTNVKVAVVGKKTAVALTQ
NGIMPDFIPPNYVADDLAANFPSVKNLNILFPRVQSGGREVLIEELTAKGAKVDAIAAYE
SGLPPERDPQALAAIKNGNIDVITFASSKTVRNFCEILAQESNEWQKWLAGVTIASIGPQ
TSATCYEFLGRVEIEAMEYTLDGLIEAIANYYESPHTNF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactagcggcaaagtctacatagttggtgcaggcgtaggcgggatcgactacctcacc
gtcaaagcgcagcgactgatcagtcaagcggaagcgatcgtctatgatgctctgatcgac
gagtcattgctagcactaacgcccgtcagttgcgatcggcactatgtcggcaagcgcggc
ggtcaactcagtatcaagcaaccagaaatcaataatttactagtaaaactttgtcagcaa
ggaaagcaagtagttcggctcaaaagcggcgatcccttcatttttgggcgggcggtgccg
gagcttgaagccttaagggcaaataattgtgaatatgagatcgtaccaggaatttccagt
gcgatcgcggcctcactcttttccggtattcccctcaccgatgccaaactcagcccttgt
tttgctgttctgactgcccatgatctcgaaaatctaccgtggccagcactagccgaaatc
ccaaccctggcgatcctgatggggaccaggggcttacagggtgaaaatcccccactttta
gccaagctaaggcagggcaaatcagccgatacaccgatcgcggtggtgcaatggtgcggt
agccatgccccagagcaacaacaaaaaatttggttaggtaccctcaccgacatacaatcg
aagttacccgattacgccctttcgcctgcggtgatcctggtgggggaagtggtcaggtat
cacgatcgattgagttggtttaggccagggcaaatggagaggcataataaagcgcttact
ggcataactgtgatggtgaccagagctacagggcaatcgagccagtttagtcaaatgctg
atagatactggtgcacgggtggtggaaatgccaaccctggcgatcctgccgccggatagt
tgggcagatttggatcgggcgatcgcaaacctagatcgttacgattggttgattcttacc
tctgccaatggcgtgtatagtttctttgagcgattgcaccatgcccaaaaagatagtcgg
gcgttgaccaatgtcaaagttgccgtggttggcaaaaaaacagcggtagcactcacccag
aatggcatcatgccagattttatcccgcctaactatgtggcagatgacctggccgcaaat
ttcccttcggtcaaaaatttaaatatcttgttccccagggtgcaaagtggcgggcgcgaa
gtcttaattgaagaattaactgccaaaggggcaaaggtggatgcgatcgcggcctatgaa
tcgggtttaccgcctgagcgcgatcctcaagcattggctgcaattaagaacggtaatata
gatgtgattacctttgccagttctaaaacagtgcgaaacttttgtgagatcctggctcag
gaaagtaacgaatggcaaaaatggttagcaggagtcacgatcgcttcgatcggaccccaa
acttcggccacctgttatgaatttctgggacgggtagaaattgaagcaatggaatatacc
ctagatggcttgattgaggcgatcgccaattattacgaatcgccccatactaatttctag

DBGET integrated database retrieval system