KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0583Help
Entry
Pse7367_0583      CDS       T02369                                 

Definition
uroporphyrinogen-III C-methyltransferase, uroporphyrinogen-III synthase (EC:4.2.1.75 2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pse7367_0583
Enzymes [BR:pseu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Pse7367_0583
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Pse7367_0583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
748220..749779
Genome map
AA seq 519 aa AA seqDB search
MTSGKVYIVGAGVGGIDYLTVKAQRLISQAEAIVYDALIDESLLALTPVSCDRHYVGKRG
GQLSIKQPEINNLLVKLCQQGKQVVRLKSGDPFIFGRAVPELEALRANNCEYEIVPGISS
AIAASLFSGIPLTDAKLSPCFAVLTAHDLENLPWPALAEIPTLAILMGTRGLQGENPPLL
AKLRQGKSADTPIAVVQWCGSHAPEQQQKIWLGTLTDIQSKLPDYALSPAVILVGEVVRY
HDRLSWFRPGQMERHNKALTGITVMVTRATGQSSQFSQMLIDTGARVVEMPTLAILPPDS
WADLDRAIANLDRYDWLILTSANGVYSFFERLHHAQKDSRALTNVKVAVVGKKTAVALTQ
NGIMPDFIPPNYVADDLAANFPSVKNLNILFPRVQSGGREVLIEELTAKGAKVDAIAAYE
SGLPPERDPQALAAIKNGNIDVITFASSKTVRNFCEILAQESNEWQKWLAGVTIASIGPQ
TSATCYEFLGRVEIEAMEYTLDGLIEAIANYYESPHTNF
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgactagcggcaaagtctacatagttggtgcaggcgtaggcgggatcgactacctcacc
gtcaaagcgcagcgactgatcagtcaagcggaagcgatcgtctatgatgctctgatcgac
gagtcattgctagcactaacgcccgtcagttgcgatcggcactatgtcggcaagcgcggc
ggtcaactcagtatcaagcaaccagaaatcaataatttactagtaaaactttgtcagcaa
ggaaagcaagtagttcggctcaaaagcggcgatcccttcatttttgggcgggcggtgccg
gagcttgaagccttaagggcaaataattgtgaatatgagatcgtaccaggaatttccagt
gcgatcgcggcctcactcttttccggtattcccctcaccgatgccaaactcagcccttgt
tttgctgttctgactgcccatgatctcgaaaatctaccgtggccagcactagccgaaatc
ccaaccctggcgatcctgatggggaccaggggcttacagggtgaaaatcccccactttta
gccaagctaaggcagggcaaatcagccgatacaccgatcgcggtggtgcaatggtgcggt
agccatgccccagagcaacaacaaaaaatttggttaggtaccctcaccgacatacaatcg
aagttacccgattacgccctttcgcctgcggtgatcctggtgggggaagtggtcaggtat
cacgatcgattgagttggtttaggccagggcaaatggagaggcataataaagcgcttact
ggcataactgtgatggtgaccagagctacagggcaatcgagccagtttagtcaaatgctg
atagatactggtgcacgggtggtggaaatgccaaccctggcgatcctgccgccggatagt
tgggcagatttggatcgggcgatcgcaaacctagatcgttacgattggttgattcttacc
tctgccaatggcgtgtatagtttctttgagcgattgcaccatgcccaaaaagatagtcgg
gcgttgaccaatgtcaaagttgccgtggttggcaaaaaaacagcggtagcactcacccag
aatggcatcatgccagattttatcccgcctaactatgtggcagatgacctggccgcaaat
ttcccttcggtcaaaaatttaaatatcttgttccccagggtgcaaagtggcgggcgcgaa
gtcttaattgaagaattaactgccaaaggggcaaaggtggatgcgatcgcggcctatgaa
tcgggtttaccgcctgagcgcgatcctcaagcattggctgcaattaagaacggtaatata
gatgtgattacctttgccagttctaaaacagtgcgaaacttttgtgagatcctggctcag
gaaagtaacgaatggcaaaaatggttagcaggagtcacgatcgcttcgatcggaccccaa
acttcggccacctgttatgaatttctgggacgggtagaaattgaagcaatggaatatacc
ctagatggcttgattgaggcgatcgccaattattacgaatcgccccatactaatttctag

DBGET integrated database retrieval system