KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0712Help
Entry
Pse7367_0712      CDS       T02369                                 

Definition
(RefSeq) L-threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pse7367_0712
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pse7367_0712
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pse7367_0712
Enzymes [BR:pseu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pse7367_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
909106..910221
Genome map
AA seq 371 aa AA seqDB search
MVLTDVLSTHFALNSTNTTFQGWPGLIRKYAKYLPVSDQTPVVTLHEGNTPLIPVPAISD
RVGRDVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGATTVICASTGNTSAAAAAYAKRG
GLRAFVLIPDGKIALGKLGQALIYGAEVIAIDGNFDKALELVRQMADQYPITLVNSINPY
RIEGQKTAAFEVIEALGEAPDWLCIPVGNAGNITAYWTGFRQYQEAGKSQKLPRMMGFQA
AGSAPIVTGKMVEHPETVATAIRIGNPANWTRAIAVQTESGGAFNSVTDEEIMNAYRILA
GEEGVFCEPASAASVAGLLKLSDQVPTGATIVCVLTGNGLKDPDAAIKGANQHFHQGIAP
DPASIAKIMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggtattaacagacgtgctttcaacccatttcgctttaaattcaacgaatacaacattt
caaggttggccaggactaattcgtaaatatgcaaagtatttacccgtctctgaccagacc
ccggtagtgacactccatgagggcaacacgccgctaattccggtgccagcgatcagcgat
cgggtggggcgagatgtcaaggtatatgtgaaatatgatggtcttaaccccaccggcagc
ttcaaggatcggggcatgaccatggcgatctccaaagccaaagaagctggagccaccacc
gtaatttgtgctagcactggcaatacttcagcggcagcagcagcctatgccaagcgaggt
ggcctacgcgcatttgtgttaattcccgatggcaagatagccctgggtaaattgggacaa
gcgttgatctatggcgcagaagtgatcgccatcgatggcaattttgataaggcgttggaa
ttggtacggcagatggccgatcaatatcccattaccctggttaactccattaatccttac
cggattgaaggccaaaaaaccgctgcctttgaagtgattgaagccttgggcgaggctccc
gattggctctgtattccagtgggcaatgcgggtaatattaccgcctattggactgggttt
aggcaatatcaagaagccggaaaatcccaaaagctgcctcggatgatgggtttccaagcc
gcaggctctgcgccgatcgtcaccggcaaaatggttgaacatcccgaaaccgtggccact
gccattagaattggcaatccagctaattggaccagggcgatcgccgtccaaaccgaaagc
ggcggtgcgtttaatagcgtcactgacgaagagatcatgaatgcctatcgaatcctggcg
ggagaggaaggtgtattttgtgagcctgctagtgcggcctcagtggcgggattactaaaa
cttagcgatcaagtacccaccggcgcaacgatcgtttgtgtgctaactggtaatggcctc
aaagatccagatgccgcgatcaagggagcaaatcaacatttccatcaaggcatagcccca
gatccggctagcattgctaaaatcatgggtttttaa

DBGET integrated database retrieval system