KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0712Help
Entry
Pse7367_0712      CDS       T02369                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00260  Glycine, serine and threonine metabolism
pseu00750  Vitamin B6 metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
pseu01120  Microbial metabolism in diverse environments
pseu01230  Biosynthesis of amino acids
Module
pseu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pse7367_0712
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pse7367_0712
Enzymes [BR:pseu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pse7367_0712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AFY69014
UniProt: K9SGU5
Position
909106..910221
Genome map
AA seq 371 aa AA seqDB search
MVLTDVLSTHFALNSTNTTFQGWPGLIRKYAKYLPVSDQTPVVTLHEGNTPLIPVPAISD
RVGRDVKVYVKYDGLNPTGSFKDRGMTMAISKAKEAGATTVICASTGNTSAAAAAYAKRG
GLRAFVLIPDGKIALGKLGQALIYGAEVIAIDGNFDKALELVRQMADQYPITLVNSINPY
RIEGQKTAAFEVIEALGEAPDWLCIPVGNAGNITAYWTGFRQYQEAGKSQKLPRMMGFQA
AGSAPIVTGKMVEHPETVATAIRIGNPANWTRAIAVQTESGGAFNSVTDEEIMNAYRILA
GEEGVFCEPASAASVAGLLKLSDQVPTGATIVCVLTGNGLKDPDAAIKGANQHFHQGIAP
DPASIAKIMGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtggtattaacagacgtgctttcaacccatttcgctttaaattcaacgaatacaacattt
caaggttggccaggactaattcgtaaatatgcaaagtatttacccgtctctgaccagacc
ccggtagtgacactccatgagggcaacacgccgctaattccggtgccagcgatcagcgat
cgggtggggcgagatgtcaaggtatatgtgaaatatgatggtcttaaccccaccggcagc
ttcaaggatcggggcatgaccatggcgatctccaaagccaaagaagctggagccaccacc
gtaatttgtgctagcactggcaatacttcagcggcagcagcagcctatgccaagcgaggt
ggcctacgcgcatttgtgttaattcccgatggcaagatagccctgggtaaattgggacaa
gcgttgatctatggcgcagaagtgatcgccatcgatggcaattttgataaggcgttggaa
ttggtacggcagatggccgatcaatatcccattaccctggttaactccattaatccttac
cggattgaaggccaaaaaaccgctgcctttgaagtgattgaagccttgggcgaggctccc
gattggctctgtattccagtgggcaatgcgggtaatattaccgcctattggactgggttt
aggcaatatcaagaagccggaaaatcccaaaagctgcctcggatgatgggtttccaagcc
gcaggctctgcgccgatcgtcaccggcaaaatggttgaacatcccgaaaccgtggccact
gccattagaattggcaatccagctaattggaccagggcgatcgccgtccaaaccgaaagc
ggcggtgcgtttaatagcgtcactgacgaagagatcatgaatgcctatcgaatcctggcg
ggagaggaaggtgtattttgtgagcctgctagtgcggcctcagtggcgggattactaaaa
cttagcgatcaagtacccaccggcgcaacgatcgtttgtgtgctaactggtaatggcctc
aaagatccagatgccgcgatcaagggagcaaatcaacatttccatcaaggcatagcccca
gatccggctagcattgctaaaatcatgggtttttaa

DBGET integrated database retrieval system