KEGG   Pseudanabaena sp. PCC 7367: Pse7367_0842Help
Entry
Pse7367_0842      CDS       T02369                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pse7367_0842
Enzymes [BR:pseu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pse7367_0842
Exosome [BR:pseu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pse7367_0842
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1082577..1084088
Genome map
AA seq 503 aa AA seqDB search
MTDHKYVLALDLGTTGNRAILFDKNGNVFAQEYKELTQHYPQPGWLEHDPIEIWQGVLRC
MQRVVKNNGVNAEEIAAIGLTVQRETCLLWDKNTGEPLHNAIVWQDRRTAPMCKELAAAG
HAADIRDRTGLVLDAYFSATKLAWLLNWVKEHKPEVDLEQVQAGTVDTWVLWNLTKGVHA
TDHSNASRTMLMNLGTEQWDYSLLELFNIPPRIMPKIQPSMSLFGQIDAEFLGAAIPVMA
IFGDQQASLFAHGGDQPGMLKCTYGTGCFLISQMGHEIGGKSSPELLATVAWSQSQPDGS
MKVNYAVEGAMFTTGACIQWLRDGIQLIKSAPETEAMCNQVESTNGVYFVPALSGLGAPH
WDMNARGAFLGITGGVKREHMVRSVLESIAYQVKEVVNSMNKNSSSPVSYLKVDGGASQN
NFLMQFQADALGIPVERPVILDATAQGAAFGAGLAAGFWDSYAELIKARKVDRVFEPGAG
QTYVEANFPTWQKAVARAKNWIE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcataaatatgtattagcgcttgaccttggtactacgggcaatcgcgccatt
ttgtttgacaaaaacggtaatgtgtttgctcaggaatataaggaattaactcaacattat
ccacagcccggttggttggagcatgacccgatcgagatctggcaaggtgtgctgcgttgt
atgcaaagggtggttaaaaataatggtgttaacgctgaggaaatcgccgcgatcggcctg
accgtgcagcgcgaaacctgcttactgtgggataaaaatactggcgagcccctgcataat
gcaattgtctggcaagatcgacgcaccgcgcccatgtgtaaagaactggcagcggcggga
catgctgctgatatccgcgatcgcactggtctggtcttagacgcttatttttcggctacc
aaactggcctggttattaaactgggtaaaagagcataaaccggaggtcgatttagagcag
gtgcaggcaggaaccgttgatacctgggtgttgtggaatctaaccaaaggagtacatgcc
accgatcatagtaatgctagccgcaccatgctgatgaatctgggaacagaacagtgggat
tatagtttgctggagctgtttaatattccgcctcgaatcatgcctaaaatccagcccagt
atgagcttgtttggccagattgatgcggagtttttaggtgcagcgatcccggttatggca
atctttggcgatcaacaggcttcactgtttgcccacggtggcgatcaacctggcatgttg
aaatgcacctatggcactggctgctttttgatctcgcaaatggggcatgaaattggtggt
aaatccagccctgaattgctggcaacggtggcctggagccagtcacaacccgatggcagc
atgaaagttaattatgcagtggaaggggcaatgttcactactggtgcatgtattcaatgg
ctgcgggatggaattcagttaattaaatctgcacctgagaccgaggcaatgtgtaatcag
gtggaaagtaccaatggggtctattttgtgcccgcattaagtggccttggtgcgccccat
tgggatatgaatgcccgtggtgcttttttggggatcactggcggcgtaaagcgagaacac
atggtcaggtcggtgttggagtcgatcgcctaccaggtgaaagaggtggttaactccatg
aataaaaactccagtagcccagtttcctatttaaaagtagatggtggcgcaagccagaat
aatttcttgatgcagttccaggctgatgcgctggggattccggtggagcgtccggtgatt
ctggatgccacggctcagggggcggcgtttggcgctggcttagcggctggcttttgggat
agctacgcggagctgatcaaggctagaaaagtcgatcgggtgtttgaaccgggtgcaggc
caaacctatgtagaggccaacttccccacctggcaaaaggcggtggcacgggctaagaat
tggattgaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system