KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1051Help
Entry
Pse7367_1051      CDS       T02369                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pse7367_1051
Enzymes [BR:pseu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pse7367_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1347951..1348583)
Genome map
AA seq 210 aa AA seqDB search
MIGYLRGTIAGIRASESSRKSATSSILTLDVQGVGYDLIITNNAIENLAASGTEATIYTH
LQVREDQMVLFGFLAAAERDLFRQLISVSGLGTQMAIALLNTLGLQDLVKAIVTGNARVL
SLTPGVGKKTAERISLELRSKLADWRQHAGVVNPVVSAVQEDLEMALLAFGYTAKEINAA
LGAIATSPDLVNSKDVEAWLKAAIGWLSKT
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgattggttatctgcgcgggacgatcgccggtattcgcgccagtgaatcctcgcgtaag
tcggcgacctcttcgattttgaccctggatgtgcaaggagttggctacgacttgatcatt
accaacaatgcgatcgagaacctggcagcctccggcaccgaagccaccatttatacccac
ttacaggtgcgcgaagatcagatggtcttgtttggatttctggccgccgcggagcgagat
ttatttcgccagttaattagtgtatcggggttgggcacgcaaatggcgatcgccttgctt
aatactttagggctgcaggatttagtaaaagcgatcgtgaccggtaatgccagggtgctg
agcctgactccgggggtgggaaaaaaaacagcagagcggatttcattggagttgcgatcg
aaactagccgattggcggcaacatgcgggggtggtcaatccagtggtgtcggcagtgcag
gaagatctagaaatggctttgctagcatttggttatacggccaaggaaattaatgcggcg
ctgggggcgatcgccacttcacctgatctggtcaacagtaaagacgtggaagcctggtta
aaagcagcgatcggctggctgagcaaaacttaa

DBGET integrated database retrieval system