KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1126Help
Entry
Pse7367_1126      CDS       T02369                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Pse7367_1126
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pse7367_1126
Enzymes [BR:pseu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Pse7367_1126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1433126..1434535)
Genome map
AA seq 469 aa AA seqDB search
MEKLTSNPNNLDLVEAKPPNTSYLVQRSRLVGQVRVSGAKNSVLRLLAASLLTSETVCLE
NYPASLLDAQVQAGMLQKLGKNCQITANKITIAEPESITSTLNWQGRSIRNTLLILGALV
ARTGSGSVPLPGGCQIGNPGNSSNISNSKSEQVDDRDRPQPVVGNGDRKFDLHEMLLRQM
GAEVWIENNQLCAAVKDKYHGKLQGSDIHLPIRSTGATENAIICGSLATGITRVWNPHIR
PEILDLINYLRSMGAKIQVFGQEHIEITGVAGLKGTNYRVLADNMEAITWLVGAVITGGD
LEIQDFPYGNLEIPLIHLRESGTKFYRGDHSLIVRGGRCYPVEIATGPYPGINSDMQPLF
AVYGAIARGESKIIDLRFPGRYGYAQELAKMGVQFAIDGNLLKIQGGHALAGAMVKALDL
RAGVALTLAGLVAAGETRVSNSWQVERGYDNFVSKAQSLGARLQRYIEY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactaaccagcaaccccaacaacctggatctggtcgaagctaaaccgccgaat
acatcatatttggtacagcgatcgcgcctggttggtcaagttcgtgtcagtggcgcaaaa
aatagtgtcttgcggcttctggcggccagtttgctcaccagcgaaactgtctgtttggaa
aactatcccgcgagcctgctggatgctcaggtgcaggcagggatgttgcaaaagctgggc
aaaaattgtcagattacagccaacaaaattacgatcgctgagccagaatcgattacttct
acgctcaattggcaggggcgatcgattcgtaataccctgctaatcttgggcgcattggtg
gccagaactggcagcggtagtgtgcctttgccgggtggttgccaaattggtaatcctggt
aatagcagcaatattagtaatagtaagtctgagcaagttgatgatcgcgatcgacctcag
ccagtggttgggaatggcgatcgtaaatttgacttgcatgaaatgttgctgcgccagatg
ggggcagaagtctggattgaaaataaccagctttgtgccgcagtaaaggataaatatcac
ggtaagcttcagggcagcgatattcatctgccgattcgatcgacgggagccacggaaaat
gcaatcatctgtggatcactggccaccggcatcaccagggtttggaatccccacatccgg
ccagagatcctggatttaattaattatctgcgcagcatgggtgccaaaatccaggttttt
ggtcaggagcacattgagatcactggcgtagcgggactaaagggcacaaactaccgcgtt
ttggccgataacatggaggcgatcacctggctggtgggggcggtgattactggcggcgat
ctggaaattcaagatttcccctatggcaacctggaaattcccttgattcatctgcgtgaa
agcggtacaaagttttatcgcggtgaccatagtctgattgtgcgcggtggcaggtgctat
ccggtggagatcgccactggcccctatcctggcatcaattcagatatgcagccgctgttt
gctgtctatggtgcgatcgcccggggtgagtcaaaaatcattgatctgcgctttcctggt
cgctatggttatgcccaggaactggccaaaatgggagtacaatttgcgatcgatggtaat
ctgctgaaaatccaaggtggtcatgctctcgctggcgcgatggttaaagcgttagacctc
agggcaggagtagcactaaccttggctggtttggtggcagcaggtgaaaccagggtcagc
aattcatggcaggtggagcggggctacgataattttgtgagcaaagctcaaagtcttggt
gctagattgcaacgatatattgaatattga

DBGET integrated database retrieval system