KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1217Help
Entry
Pse7367_1217      CDS       T02369                                 

Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pseu01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:pseu00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:pseu00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1546302..1547630)
Genome map
AA seq 442 aa AA seqDB search
MTSTASNPTATAATNYSADRHANFNGLKCKECGTEYEAKAIHVCELCFGPLEVVYDYEAI
AEKVSRESIKEGPISIWRYREFLPVATDDYIDTSTGMTPLLKANRLARRLGIKELYIKND
AVNMPTLSFKDRVVSVALSRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADL
EAGKVLGTLVYAPKVFAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEV
AEQLGWKLPDHIVAPLASGSLYTKIYKGFQEFVKVGLVDDKPVRFSGAQAEGCSPIAQAF
REGRDFIAPVKPKTIAKSIAIGNPADGVYALDIARKTNGNIESVNDAEIVEGMKLLAETE
GVFTETAGGTTIAVLKKLVEAGKINPDETTVVYITGNGLKTQEAVQGYIGEPLQIEPKLD
SFERAFERSLTLDRLEWQTVSV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaactgcatctaatcccactgctactgccgctactaactacagtgccgatcgc
cacgccaacttcaatggcctcaagtgtaaagaatgtggcactgaatacgaagccaaagcg
atccacgtatgtgaattatgttttggcccattggaagtggtttatgactatgaggcgatc
gccgagaaagtgagccgcgagagcatcaaggaaggccccatttcaatctggcgctatcgt
gagtttttgcccgttgctactgatgactacatcgacaccagcactggcatgacccccctc
ctcaaggcaaatcggttggccagaaggttaggcatcaaagagctttatattaaaaacgat
gcggtgaatatgcccaccctcagtttcaaggatcgggtggtttcagtggcgctcagccgt
gcccgtgagctgggttttagcactgtgtcctgtgccagtactggtaatttggccaactcc
accgcggcgatcgctgcccatgctggcctcgattgctgtgtgtttattcccgccgactta
gaagctggtaaggtgttgggcacgttggtatatgcacccaaggtatttgcggtgcaaggt
aactatgaccaggtcaatcgcctttgctctgaggttgctaacacccacggttggggcttt
gtgaatattaatctgcgtccttactactccgaaggttccaagaccctgggctttgaggtg
gctgagcagttgggctggaaattgcccgatcacattgtggcaccattggcctctggatcg
ctttataccaagatttacaaaggcttccaggaatttgtgaaagttggcctagtcgatgac
aagccagtccgatttagtggcgctcaggccgagggttgctcaccgatcgcccaggcattt
agggaaggccgcgactttattgccccagtcaagccaaaaacgatcgctaagagcattgcg
atcggtaatccggcggatggcgtttatgccctcgatattgcccgcaagaccaatggcaat
attgaatctgtgaacgatgccgaaattgtggaggggatgaagctattggccgaaaccgag
ggtgtcttcacggaaaccgctggcggtactacgatcgccgtgttgaagaagctggttgaa
gcaggcaaaatcaacccagatgaaaccactgtggtttatattactggtaatggcctcaaa
acccaggaagcagtgcagggctacattggcgagccgttgcaaattgaacccaaactagac
agctttgagcgggcatttgagcgctccctaaccctcgatcgtctagagtggcagactgtt
tcggtctaa

DBGET integrated database retrieval system