KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1217Help
Entry
Pse7367_1217      CDS       T02369                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00260  Glycine, serine and threonine metabolism
pseu00750  Vitamin B6 metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
pseu01120  Microbial metabolism in diverse environments
pseu01230  Biosynthesis of amino acids
Module
pseu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pse7367_1217
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Pse7367_1217
Enzymes [BR:pseu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Pse7367_1217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP NinF TF_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: AFY69512
UniProt: K9SFW7
Position
complement(1546302..1547630)
Genome map
AA seq 442 aa AA seqDB search
MTSTASNPTATAATNYSADRHANFNGLKCKECGTEYEAKAIHVCELCFGPLEVVYDYEAI
AEKVSRESIKEGPISIWRYREFLPVATDDYIDTSTGMTPLLKANRLARRLGIKELYIKND
AVNMPTLSFKDRVVSVALSRARELGFSTVSCASTGNLANSTAAIAAHAGLDCCVFIPADL
EAGKVLGTLVYAPKVFAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEV
AEQLGWKLPDHIVAPLASGSLYTKIYKGFQEFVKVGLVDDKPVRFSGAQAEGCSPIAQAF
REGRDFIAPVKPKTIAKSIAIGNPADGVYALDIARKTNGNIESVNDAEIVEGMKLLAETE
GVFTETAGGTTIAVLKKLVEAGKINPDETTVVYITGNGLKTQEAVQGYIGEPLQIEPKLD
SFERAFERSLTLDRLEWQTVSV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaactgcatctaatcccactgctactgccgctactaactacagtgccgatcgc
cacgccaacttcaatggcctcaagtgtaaagaatgtggcactgaatacgaagccaaagcg
atccacgtatgtgaattatgttttggcccattggaagtggtttatgactatgaggcgatc
gccgagaaagtgagccgcgagagcatcaaggaaggccccatttcaatctggcgctatcgt
gagtttttgcccgttgctactgatgactacatcgacaccagcactggcatgacccccctc
ctcaaggcaaatcggttggccagaaggttaggcatcaaagagctttatattaaaaacgat
gcggtgaatatgcccaccctcagtttcaaggatcgggtggtttcagtggcgctcagccgt
gcccgtgagctgggttttagcactgtgtcctgtgccagtactggtaatttggccaactcc
accgcggcgatcgctgcccatgctggcctcgattgctgtgtgtttattcccgccgactta
gaagctggtaaggtgttgggcacgttggtatatgcacccaaggtatttgcggtgcaaggt
aactatgaccaggtcaatcgcctttgctctgaggttgctaacacccacggttggggcttt
gtgaatattaatctgcgtccttactactccgaaggttccaagaccctgggctttgaggtg
gctgagcagttgggctggaaattgcccgatcacattgtggcaccattggcctctggatcg
ctttataccaagatttacaaaggcttccaggaatttgtgaaagttggcctagtcgatgac
aagccagtccgatttagtggcgctcaggccgagggttgctcaccgatcgcccaggcattt
agggaaggccgcgactttattgccccagtcaagccaaaaacgatcgctaagagcattgcg
atcggtaatccggcggatggcgtttatgccctcgatattgcccgcaagaccaatggcaat
attgaatctgtgaacgatgccgaaattgtggaggggatgaagctattggccgaaaccgag
ggtgtcttcacggaaaccgctggcggtactacgatcgccgtgttgaagaagctggttgaa
gcaggcaaaatcaacccagatgaaaccactgtggtttatattactggtaatggcctcaaa
acccaggaagcagtgcagggctacattggcgagccgttgcaaattgaacccaaactagac
agctttgagcgggcatttgagcgctccctaaccctcgatcgtctagagtggcagactgtt
tcggtctaa

DBGET integrated database retrieval system