KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1454Help
Entry
Pse7367_1454      CDS       T02369                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pse7367_1454
DNA repair and recombination proteins [BR:pseu03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pse7367_1454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1850127..1850723
Genome map
AA seq 198 aa AA seqDB search
MYTRPLANLIEQFQRLPGIGAKTAQRLALHILKRPEAEVEALATALTAAKQKVGMCQVCG
HLSAEPVCEICSDDRRDDTTICVIADSRDLIALEKTREYKGKYHVLGGLISPMDGIGPDQ
LNIQSLLRRASSGKIDEVIMAISPSVEGETTTLYVGGLLKNFTRVTRIAFGIPMGGDLEY
ADEITLAKAIEGRRELES
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
ttgtatactcgcccgcttgccaacctgatcgaacaattccaacgactgccagggatcggt
gctaaaactgcccagcgcctagctttgcatattctcaaacgccccgaagcagaagtggaa
gcgctcgccactgccctcactgctgccaaacaaaaagtgggcatgtgccaggtatgtgga
catttatccgcagagccagtgtgcgaaatttgcagcgacgatcgccgcgatgatacgaca
atctgtgtgatcgctgactcccgcgatttgatcgcgttggaaaaaacccgcgagtataag
ggcaaatatcatgtgctgggtggcttgatttcaccgatggatgggatcggccccgatcaa
ttaaatattcaaagcctgctgcgccgcgctagttcgggcaagattgatgaggtgatcatg
gcgatctcaccgagtgtggaaggggaaaccaccacgctatatgtgggtgggttgctcaag
aattttacgcgggtgacccggattgcgtttggcattccaatggggggcgatctggaatat
gcggacgagattacgttggcgaaggcgatcgagggtaggcgggagctagaaagttag

DBGET integrated database retrieval system