KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1792Help
Entry
Pse7367_1792      CDS       T02369                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
pseu  Pseudanabaena sp. PCC 7367
Brite
Enzymes [BR:pseu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Pse7367_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2256941..2257633
Genome map
AA seq 230 aa AA seqDB search
MAIDLYYWATPNGHKITIFLEEAGLEYNLKPINIMKGDQFKPEFLKIAPNNRIPAIVDHD
PIDGGEPISIFESGAILFYLAQKIGKFIPSEIRGNTEVLQWLMWQMGGLGPMMGQANHFV
RYAPEPIEYAERRYLKETRRLFGVMEKRLNDRAYLVGEYSIADMACYPWTKADASLEVDT
EQEFPHVYQWQQTIGDRAAVIKAYEIGDRVRSNTKLDDQARKNLFGDRQK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgatctttattactgggctactcccaacggtcacaaaatcacgattttccta
gaagaggccggtttggagtacaatctcaagccaattaacatcatgaagggcgatcaattc
aagccagagtttttgaaaattgcccccaataatcgtattccagcgatcgttgaccatgat
ccgatcgacggcggtgagccgatttcgatctttgaatcaggagcaattctgttctatctg
gcgcaaaagattggcaaattcattcccagtgagattcggggtaataccgaagtgctgcaa
tggttgatgtggcaaatgggtggcctggggccaatgatggggcaagctaaccactttgtc
cgctatgcacctgagccgatcgagtatgctgaaaggcgctacctcaaggaaaccaggcgt
ttatttggcgtaatggaaaaacgtttaaacgatcgtgcttatctggtgggagaatattcg
atcgcggatatggcctgctatccctggactaaggcagatgccagtttggaagttgatacg
gagcaagagtttccccatgtttaccaatggcagcagaccattggcgatcgcgcagcggtg
atcaaagcctatgaaattggcgatcgggtgcgaagtaataccaagcttgatgatcaagca
cgcaagaacttgtttggcgatcgccagaagtaa

DBGET integrated database retrieval system