KEGG   Pseudanabaena sp. PCC 7367: Pse7367_1792Help
Entry
Pse7367_1792      CDS       T02369                                 

Definition
glutathione S-transferase
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pse7367_1792
Enzymes [BR:pseu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Pse7367_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2256941..2257633
Genome map
AA seq 230 aa AA seqDB search
MAIDLYYWATPNGHKITIFLEEAGLEYNLKPINIMKGDQFKPEFLKIAPNNRIPAIVDHD
PIDGGEPISIFESGAILFYLAQKIGKFIPSEIRGNTEVLQWLMWQMGGLGPMMGQANHFV
RYAPEPIEYAERRYLKETRRLFGVMEKRLNDRAYLVGEYSIADMACYPWTKADASLEVDT
EQEFPHVYQWQQTIGDRAAVIKAYEIGDRVRSNTKLDDQARKNLFGDRQK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggcgatcgatctttattactgggctactcccaacggtcacaaaatcacgattttccta
gaagaggccggtttggagtacaatctcaagccaattaacatcatgaagggcgatcaattc
aagccagagtttttgaaaattgcccccaataatcgtattccagcgatcgttgaccatgat
ccgatcgacggcggtgagccgatttcgatctttgaatcaggagcaattctgttctatctg
gcgcaaaagattggcaaattcattcccagtgagattcggggtaataccgaagtgctgcaa
tggttgatgtggcaaatgggtggcctggggccaatgatggggcaagctaaccactttgtc
cgctatgcacctgagccgatcgagtatgctgaaaggcgctacctcaaggaaaccaggcgt
ttatttggcgtaatggaaaaacgtttaaacgatcgtgcttatctggtgggagaatattcg
atcgcggatatggcctgctatccctggactaaggcagatgccagtttggaagttgatacg
gagcaagagtttccccatgtttaccaatggcagcagaccattggcgatcgcgcagcggtg
atcaaagcctatgaaattggcgatcgggtgcgaagtaataccaagcttgatgatcaagca
cgcaagaacttgtttggcgatcgccagaagtaa

DBGET integrated database retrieval system