KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2251Help
Entry
Pse7367_2251      CDS       T02369                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pse7367_2251
Enzymes [BR:pseu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pse7367_2251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2852907..2853521
Genome map
AA seq 204 aa AA seqDB search
MARCAIAIGSNLGDSLQIVADAIAQLNSNPQLEVVQLSRWYKTKAVTKLITRTVNVGAGL
RSPSTPLDSLVSGFPSDGFDDLNGSPQPDFINGCAIAETSLSPLAILALLLELEKNFGRQ
RRKRWDARTLDLDLLLYDDLVLELPELILPHPRMGDRAFVMLPLVEIAPDWWHPIFGKTI
AELALDPPDLNVCQPIPLEQDVSA
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctcgatgtgcgatcgcaataggcagtaatttaggcgactctttgcagatagttgcc
gatgccatagcgcaattaaacagcaatccccagctagaagttgtgcaattgtcgcgctgg
tataaaaccaaggcggtgaccaaattaattacccgaaccgtgaatgttggtgcaggattg
cgatcgccctcaacgccattggatagcttggtgagcggttttccaagcgatgggtttgat
gatttgaacggatcacctcagccagattttatcaatggttgtgcgatcgccgaaacctct
ttgtcccccctggcaatcctggcattgttgctagagcttgagaaaaactttggccgacaa
cgccggaaacgctgggatgcccgcaccctggatctagatttattgctctatgatgatctg
gtgctggagttaccagaattaattttaccgcacccgcgcatgggcgatcgtgcctttgtg
atgctccccctggtggaaattgcccccgattggtggcatcctatatttggcaagacgatc
gctgaattagccctcgatccgcctgatctaaatgtttgtcagccaatccccttggagcag
gatgtttcagcttag

DBGET integrated database retrieval system