KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2287Help
Entry
Pse7367_2287      CDS       T02369                                 

Definition
protoporphyrinogen oxidase (EC:1.3.3.4)
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pse7367_2287
Enzymes [BR:pseu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Pse7367_2287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2891069..2892577)
Genome map
AA seq 502 aa AA seqDB search
MSNHNHAGSPIDLLVVGAGISGLTVAHDLASNSVAEANGSNQLRIIVTEAQNRVGGAIVS
QRDEVGFQWEEGPNSFQPAPELLKLAAAVGLKDELVFADGKLPRFVFWNGKLNALPMSPQ
LLTKFNLLTIKGKLRAFLGAIGFVRPAAAGEETVAQFFKRHLGQEVVDRLVVPFISGVYA
GNTDKLSAAAAFGKIFRLEKNYNGLVAGAILSRLAKRKQEKAQTNQPANIYDRQEIPKTK
PGQLGSFKNGIEALPRAIAEDLIDKGHEVRLQWRLDKIQPNSDGTYSATYETPHGIETIT
ARALLLTTPAYVSSMLLQDIAPDAAQSLGEIYYPPVACVVLGYPDAAMKRDMNGFGNLIP
RSQGIRTLGTIWGSSLFSDRAPAGYHLLLNFIGGSLDTGIADLSEPEIAQAVHSDLKQTL
LKPDTTIEPKVLAVHLWQRAIPQYEVGHLDRLARVERDLANHPGLFVSANFIGGVALGDC
VKRSFGTAEQIKGFLNLSTKKK
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaccataatcatgctggctcaccgatcgacctgttggtagttggcgctgggatc
agtggcctcaccgtggctcatgacctggccagcaattctgtcgctgaggctaatgggtca
aaccagctcaggattatcgtcaccgaggcacaaaatcgggtgggcggggcgatcgtctcg
cagcgggatgaagtaggttttcaatgggaagaagggcccaatagctttcagccagcccca
gagctactcaaactggcggcggcggtggggctaaaggatgaattagtatttgcggatggc
aagttgcccaggtttgtgttctggaatgggaagttaaatgctctgcccatgtcaccgcag
ctgctaaccaaatttaatttattaacgatcaagggcaagctaagggctttcctgggggcg
atcggctttgtgcgaccagcggcagcgggggaagaaactgtggcgcagttttttaagcgg
catctggggcaagaggtggtcgatcggctggtagtaccgttcatctctggggtttatgca
ggcaatacggacaagctgagtgcggcggcggcatttggcaagattttccggttagaaaaa
aactacaatggtctggtggcgggggcgatcctgtcgcggttggccaagcgcaagcaagag
aaggcgcaaaccaaccagccagcaaatatttacgatcgccaggagatccccaaaaccaag
ccaggacagttgggatcatttaaaaatgggattgaggctctgcccagggcgatcgccgaa
gatttaatcgacaaaggtcatgaggtgcgattgcaatggcggttggacaaaatccagccc
aactctgatgggacatatagcgccacctatgagacaccccacgggatcgaaacgatcacg
gcgcgggctttgctccttactacgcctgcctatgtttccagtatgctgctgcaagatatt
gcccctgatgcagctcaatctttgggtgagatttattacccgccagtggcctgtgtggtg
ttggggtatccggatgcggcgatgaaacgggatatgaatgggtttggtaatttgatcccg
cgtagtcagggcatccgtacgttgggcacgatctggggatcgagtttgtttagcgatcgc
gctccggctggctatcatctgctgctgaattttattggtgggtcgttggatactggcatt
gccgatctatctgaacctgaaatagctcaggcggtgcatagtgacctgaagcaaacgttg
ctgaaaccagacaccacgatcgaaccgaaggtgttggcggtgcatttgtggcaacgggcg
atcccgcagtatgaggtcggtcacctcgatcgattggcgcgggttgaaagggatctggct
aatcatcctgggttgtttgtgagtgctaattttattggtggcgtggcgctgggggattgt
gtgaagaggagttttggtacggctgaacaaattaaggggtttttaaatctgtctactaaa
aaaaaataa

DBGET integrated database retrieval system