KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2358Help
Entry
Pse7367_2358      CDS       T02369                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pse7367_2358
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pse7367_2358
   00520 Amino sugar and nucleotide sugar metabolism
    Pse7367_2358
Enzymes [BR:pseu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Pse7367_2358
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2975755..2976468
Genome map
AA seq 237 aa AA seqDB search
MTEEKLTLAIDVGGSGIKAMVLLPDGTPKTERVRLETPQPSTTDAVVATIIKLAEMQGEF
DRVSVGFPSVVRNGVTQKANNLGDTWHDFDLAKVLQTEFKRPVRVANDADIQGLGAIAGT
GTELVITLGTGFGSALFIDGRLVPNLELCNHYFMHGKNKEKSYEDALGDQALEKIGKKDW
NKRLAKAIDSLEALFNYDYLYIGGGNSKHIKFELPSNVKIIPNITGILGGIALWRDV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgacagaagaaaaattgaccctggcgattgatgtgggcggcagtggcattaaagcaatg
gtcttgttgccggatggtacgcccaaaaccgaaagagtgcgcctggaaacgccgcaacca
tctacaaccgatgcggtggtggctacgatcattaagctggcggaaatgcagggcgagttc
gatcgtgtttcggttggttttcccagcgtggtgcgcaatggcgtgacccagaaggcaaat
aatctgggtgatacctggcatgattttgacctggccaaggtgttgcaaactgaatttaaa
cgcccagtgcgggtagccaatgatgcggatattcaaggcttgggggcgatcgctggcact
ggtacggagttagtgattacgctggggactgggtttggctctgctctgttcattgatggc
aggctggtgccgaatttggagctttgcaatcattactttatgcatggcaaaaacaaggaa
aaaagctatgaagatgcattgggcgatcaggcgttagaaaagattggcaagaaagactgg
aataagcgtttagccaaggcgatcgattccctggaagctctgtttaattatgattatctt
tacattggcggtggtaatagcaagcatattaaatttgagctgcccagtaatgtaaaaatc
atccccaacatcactggtatcctgggtgggattgcgctctggcgagatgtttaa

DBGET integrated database retrieval system