KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2395Help
Entry
Pse7367_2395      CDS       T02369                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pse7367_2395
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Pse7367_2395
Enzymes [BR:pseu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Pse7367_2395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3030499..3032130)
Genome map
AA seq 543 aa AA seqDB search
MGEIGQINNTIATAQDSDRQGISKTWLLADLLAKSGVEYSGYGDRPVPTQVLAGAIDRLV
TDSRQCQTGDLFIGMPGTKVDGAQFALKAIRQGAVAAIISQQADISNLIDANPATPELDR
LIVVEDVIGACAAIATAFYDHPATKMQLVGVTGTNGKTTTTHIIEFLLNAQQPTALLGTL
YARWPNYINTASHTTPFAIDLQAKLRDALDDGVKAAVLEVSSHALAQRRVGGCTFAAAVF
TNLTQDHLDYHKDIEDYFQAKALLFNPVYLSGRAIVNLDDGYGQRLITDLQARSQPVWTY
SLENDSADFYADFYTEQLQYTPTGVTGILHTPVGTVDLRSTLVGSFNVANLLAAIATALH
LGMELDQVAALIPQFKAVPGRVEQVILTDGNDRKEKQDITVVVDYAHTPDSLENVLRAMR
PFTQAELVCVFGCGGDRDRTKRPLMGEIAARLADRVYVTSDNPRTEEPQGILEDILAGIP
EQVQPIVEVDRHQAIEMAILQANPGDMIVIAGKGHEDYQILGTEKIHFDDREEAQAALRQ
KYA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagatcggtcaaatcaataatacgatcgcaacagcacaggatagcgatcgccag
ggaatcagtaaaacctggttgttggcagatttgctggctaaatcaggggttgaatatagc
ggttatggcgatcggccagttcccacccaggttttggcgggggcgatcgatcgcctggtg
actgactcgcggcaatgccagaccggtgatttatttattggcatgcctggtacaaaggta
gatggcgctcagtttgcgctcaaggcgatcaggcaaggggcagtcgccgccataatttcc
cagcaagcagatatttctaatttgattgatgctaatcccgccacacctgagttagataga
ttaattgtagtagaagatgtgattggggcttgtgccgcgatcgctaccgctttttacgat
catccagcgaccaaaatgcaactggtgggggtaacgggcaccaatggcaaaaccaccacc
actcatattattgagttcttgctcaacgcccaacaacccactgccttgctgggcaccctc
tatgccagatggcccaattatattaatacggccagccacactaccccctttgcgatcgac
ctgcaagcgaaactacgcgatgccctggacgatggcgttaaggccgcagttttggaagtt
agctcccatgctctagctcaacggcgggttggtggttgcacctttgcggcggcggtattt
accaacctgacccaggatcaccttgactatcacaaagacattgaagactatttccaggcc
aaggcgctactgtttaaccctgtttatctgtcaggtcgggcgatcgtcaacctggatgat
ggctatgggcaaaggttaatcacggatttacaagccagatcgcaaccagtctggacctat
agcttagagaacgactcggccgatttttatgctgatttttatacagagcaattgcaatat
acccccactggggtgaccggcattttgcacacgccagtcggtacagtagatctgcgctct
acgctagtaggtagttttaatgtggctaacttgttggcggcgatcgccacggctttgcac
ctgggcatggagctagatcaagtagcggcactgataccccaattcaaggcagtgccaggc
cgggttgagcaggtgattctcactgatggtaatgatcgcaaagagaaacaagatattaca
gtggtggttgactatgcccacacgcccgacagtttagaaaacgtgttacgggcaatgcgg
ccatttacccaggcagagctagtttgtgtgtttggttgtggtggcgaccgcgatcgcacc
aagcgccccttgatgggtgagattgcagctaggttggccgatcgggtttatgtgacttca
gacaacccccgcaccgaggaaccccagggcattctagaagatattctggctggcatccct
gagcaagttcagccgatcgtcgaggtggatcggcatcaggcgatcgagatggcaattttg
caggccaaccctggcgatatgattgtgattgcgggcaaggggcacgaggattatcaaatt
ctgggcacagaaaagattcattttgacgatcgggaagaagctcaggcggcgctgcggcaa
aaatatgcctag

DBGET integrated database retrieval system