KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2593Help
Entry
Pse7367_2593      CDS       T02369                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pseu00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3250200..3251735
Genome map
AA seq 511 aa AA seqDB search
MQFKRSSGILLHPTSLPGGHGIGDLGKAAYEFVDFLEKSGQKLWQVLPLGPTGFGNSPYM
SFSAIAGNSFLISLDLLAEKGLLEQADFGEIPDFPTTTIDFELTKSYKGKLLKIAYERFM
KEPPSEFKTFCDQQADWLDNYAMFMAILEANKGASWHKWEKSIAKRDPVAMQTQTKLHKY
KINLHKFLQYEFYCQWHQLREYANDKGIQIIGDIPVYVAHNSADVWANPQIFELNPETFE
PALMAGVPPDYFSETGQLWGNPVYDWKYLQKTDFAWWVKRFKFLLQFVDYIRIDHFRGFE
AYWQVEEGETVATNGKWVKAPGAELFTTIRKKLGKLPIIAENLGVITDEVEALRHQFGFP
GMQVLMFAWDGNFVDNPHLPHTFEKISLVYTGTHDNDTTGGWWERVEDYQKHNLYKYLGH
QLIEDIHWTFIRIALASIADLAIMPLQDVFGLNNVARMNKPGTPDNNWAWRYEPDAIHNE
DTIRRLYEMVEIYGRLVYPESKDKDQENAND
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaaacgctccagtggaattttgctgcatccaaccagcttgcctggtggacat
gggatcggcgatcttggtaaggcagcatatgaatttgtggactttctagaaaaaagtggc
cagaaactatggcaggtcttaccactggggcccacgggctttggtaattcaccctacatg
agctttagtgcgatcgctggtaattcctttttaatcagcctcgatctgctggccgaaaag
ggtttactagagcaggcagattttggcgaaatacccgactttcccaccaccacaattgac
tttgaactgactaaatcctataagggcaagctgctcaaaattgcctatgagcgatttatg
aaagagccacccagtgaatttaaaactttttgcgatcagcaagcagactggcttgataac
tatgctatgttcatggccattttggaggccaataagggagctagctggcacaagtgggaa
aagtcgatcgccaagcgcgatccagtggcgatgcaaacccagaccaagctccataaatac
aaaatcaatttgcataaattcctgcaatacgagttctattgccaatggcatcaactacgc
gaatatgccaacgataaagggattcagattattggtgatattcctgtctatgtggctcac
aacagtgctgatgtgtgggctaacccgcaaatttttgagctaaatccagaaacctttgaa
ccagccttgatggcaggtgtaccgcccgattattttagtgagacggggcaactatggggc
aatccggtttatgactggaagtatctccagaagacagattttgcctggtgggtaaagcga
tttaaatttctacttcagtttgtggactacatccgcatcgatcattttcgcggcttcgag
gcttactggcaggtggaagagggcgaaaccgttgccactaatggtaagtgggttaaagca
cctggggctgagctattcaccacgatccgcaagaaactgggcaagttgccgatcattgcc
gagaacctgggtgtgattaccgatgaggtggaagcgctgcgacatcaatttgggttccca
gggatgcaagtattgatgtttgcctgggatggtaattttgtggataatccccatttaccc
cacacctttgagaaaataagtctggtctataccggcacccacgacaatgacactaccggt
ggctggtgggagcgggttgaggattaccagaagcacaatctctataaatatttaggccac
caattgattgaggacattcactggacgtttatccggattgccctggcttcgatcgctgat
ttggccattatgccgcttcaagatgtattcgggctaaataatgttgccaggatgaacaaa
ccgggaacccctgataacaactgggcttggcgttatgaaccagatgcgatccacaatgaa
gatacaatccgccgcctatatgaaatggtggagatttatggcagattggtttacccagag
tcaaaggataaagaccaggagaatgcgaatgattaa

DBGET integrated database retrieval system