KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2593Help
Entry
Pse7367_2593      CDS       T02369                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pse7367_2593
Enzymes [BR:pseu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Pse7367_2593
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3250200..3251735
Genome map
AA seq 511 aa AA seqDB search
MQFKRSSGILLHPTSLPGGHGIGDLGKAAYEFVDFLEKSGQKLWQVLPLGPTGFGNSPYM
SFSAIAGNSFLISLDLLAEKGLLEQADFGEIPDFPTTTIDFELTKSYKGKLLKIAYERFM
KEPPSEFKTFCDQQADWLDNYAMFMAILEANKGASWHKWEKSIAKRDPVAMQTQTKLHKY
KINLHKFLQYEFYCQWHQLREYANDKGIQIIGDIPVYVAHNSADVWANPQIFELNPETFE
PALMAGVPPDYFSETGQLWGNPVYDWKYLQKTDFAWWVKRFKFLLQFVDYIRIDHFRGFE
AYWQVEEGETVATNGKWVKAPGAELFTTIRKKLGKLPIIAENLGVITDEVEALRHQFGFP
GMQVLMFAWDGNFVDNPHLPHTFEKISLVYTGTHDNDTTGGWWERVEDYQKHNLYKYLGH
QLIEDIHWTFIRIALASIADLAIMPLQDVFGLNNVARMNKPGTPDNNWAWRYEPDAIHNE
DTIRRLYEMVEIYGRLVYPESKDKDQENAND
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttaaacgctccagtggaattttgctgcatccaaccagcttgcctggtggacat
gggatcggcgatcttggtaaggcagcatatgaatttgtggactttctagaaaaaagtggc
cagaaactatggcaggtcttaccactggggcccacgggctttggtaattcaccctacatg
agctttagtgcgatcgctggtaattcctttttaatcagcctcgatctgctggccgaaaag
ggtttactagagcaggcagattttggcgaaatacccgactttcccaccaccacaattgac
tttgaactgactaaatcctataagggcaagctgctcaaaattgcctatgagcgatttatg
aaagagccacccagtgaatttaaaactttttgcgatcagcaagcagactggcttgataac
tatgctatgttcatggccattttggaggccaataagggagctagctggcacaagtgggaa
aagtcgatcgccaagcgcgatccagtggcgatgcaaacccagaccaagctccataaatac
aaaatcaatttgcataaattcctgcaatacgagttctattgccaatggcatcaactacgc
gaatatgccaacgataaagggattcagattattggtgatattcctgtctatgtggctcac
aacagtgctgatgtgtgggctaacccgcaaatttttgagctaaatccagaaacctttgaa
ccagccttgatggcaggtgtaccgcccgattattttagtgagacggggcaactatggggc
aatccggtttatgactggaagtatctccagaagacagattttgcctggtgggtaaagcga
tttaaatttctacttcagtttgtggactacatccgcatcgatcattttcgcggcttcgag
gcttactggcaggtggaagagggcgaaaccgttgccactaatggtaagtgggttaaagca
cctggggctgagctattcaccacgatccgcaagaaactgggcaagttgccgatcattgcc
gagaacctgggtgtgattaccgatgaggtggaagcgctgcgacatcaatttgggttccca
gggatgcaagtattgatgtttgcctgggatggtaattttgtggataatccccatttaccc
cacacctttgagaaaataagtctggtctataccggcacccacgacaatgacactaccggt
ggctggtgggagcgggttgaggattaccagaagcacaatctctataaatatttaggccac
caattgattgaggacattcactggacgtttatccggattgccctggcttcgatcgctgat
ttggccattatgccgcttcaagatgtattcgggctaaataatgttgccaggatgaacaaa
ccgggaacccctgataacaactgggcttggcgttatgaaccagatgcgatccacaatgaa
gatacaatccgccgcctatatgaaatggtggagatttatggcagattggtttacccagag
tcaaaggataaagaccaggagaatgcgaatgattaa

DBGET integrated database retrieval system