KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2709Help
Entry
Pse7367_2709      CDS       T02369                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pse7367_2709
Enzymes [BR:pseu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Pse7367_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3413071..3414144
Genome map
AA seq 357 aa AA seqDB search
MTVTQAKPLTQKRPVFPFSAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAL
ANLLPEIQIVADDPFSSDPVDADLQSDEVRQRLAQGEQLPIAAKQVLMVDLPLGATEDRV
CGTIDIEKALTEGVKAFEPGLLAKANRGILYIDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPELRVKIVEQRTEFDREP
HEFIDHYQTEQVDLQKKIVTAQENLNAVGIPHELRLHISQVCAQLDVDGLRGDIVTNRAA
KALAAFEGKSEVDVDEIKRVITLCLRHRLRKDPLESIDSGYKVQKVFAEVFGLAEAE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtaacccaagccaagcccctaacccaaaaacgtcctgtcttccccttcagcgcc
attgttgggcaggaagaaatgaagctagccttgatcctcaacgtgatcgatcccaagatc
ggcggcgtaatgatcatgggcgatcgcggcacgggcaaatccaccacgatccgcgccctc
gccaacctgctcccagaaatccaaattgtcgccgacgatcccttcagcagcgatccagtc
gatgccgacctgcaaagcgacgaagtacggcaacggctcgcccagggagagcaactaccg
atcgccgccaagcaagtattgatggtcgatctgcctttgggagccaccgaagatcgcgtc
tgcggcacgatcgacattgaaaaagccctcaccgaaggggtcaaagccttcgagcccggg
ctgctcgccaaagcaaatcgcggcattttatacatcgacgaagtaaacctgctcgacgat
cacctggttgatgtgctgctggattccgccgcctccggttggaacaccgttgagcgtgaa
ggcatctcgatccgccacccggccaggtttgtgctggtgggctctggcaaccccgaagaa
ggcgagctcaggccccaactgctcgatcggttcgggatgcacgccgagatccgcaccgtc
aaagaaccagaactgcgggtcaagatcgtagaacaacgcaccgagttcgatcgggaaccc
catgagtttatcgatcactaccaaaccgagcaggttgatttacaaaagaagatcgtcacc
gcccaggaaaacctcaacgccgtaggcattccccatgagttgcgcctgcacatttcccag
gtttgtgcccagctagacgtagacgggttgcgcggtgatattgttaccaatcgcgctgcg
aaggctctggctgcgtttgagggtaagtcagaggtggatgtggatgaaattaaacgggtg
atcacgctctgtttgcggcatcgcctgcggaaagacccgctcgaatcgatcgattctggc
tataaggtgcagaaggtcttcgctgaggtctttggcttagcggaagcagaataa

DBGET integrated database retrieval system