KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2709Help
Entry
Pse7367_2709      CDS       T02369                                 

Definition
(GenBank) magnesium chelatase ATPase subunit I
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
pseu00860  Porphyrin and chlorophyll metabolism
pseu01100  Metabolic pathways
pseu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pse7367_2709
Enzymes [BR:pseu01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Pse7367_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 MCM AAA_16 AAA_22 Sigma54_activat AAA AAA_29 DUF815 ABC_tran AAA_18 MMR_HSR1 AAA_28 AAA_30 FtsK_SpoIIIE AAA_7
Motif
Other DBs
NCBI-ProteinID: AFY70964
UniProt: K9SMD8
Position
3413071..3414144
Genome map
AA seq 357 aa AA seqDB search
MTVTQAKPLTQKRPVFPFSAIVGQEEMKLALILNVIDPKIGGVMIMGDRGTGKSTTIRAL
ANLLPEIQIVADDPFSSDPVDADLQSDEVRQRLAQGEQLPIAAKQVLMVDLPLGATEDRV
CGTIDIEKALTEGVKAFEPGLLAKANRGILYIDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIRTVKEPELRVKIVEQRTEFDREP
HEFIDHYQTEQVDLQKKIVTAQENLNAVGIPHELRLHISQVCAQLDVDGLRGDIVTNRAA
KALAAFEGKSEVDVDEIKRVITLCLRHRLRKDPLESIDSGYKVQKVFAEVFGLAEAE
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
ttgaccgtaacccaagccaagcccctaacccaaaaacgtcctgtcttccccttcagcgcc
attgttgggcaggaagaaatgaagctagccttgatcctcaacgtgatcgatcccaagatc
ggcggcgtaatgatcatgggcgatcgcggcacgggcaaatccaccacgatccgcgccctc
gccaacctgctcccagaaatccaaattgtcgccgacgatcccttcagcagcgatccagtc
gatgccgacctgcaaagcgacgaagtacggcaacggctcgcccagggagagcaactaccg
atcgccgccaagcaagtattgatggtcgatctgcctttgggagccaccgaagatcgcgtc
tgcggcacgatcgacattgaaaaagccctcaccgaaggggtcaaagccttcgagcccggg
ctgctcgccaaagcaaatcgcggcattttatacatcgacgaagtaaacctgctcgacgat
cacctggttgatgtgctgctggattccgccgcctccggttggaacaccgttgagcgtgaa
ggcatctcgatccgccacccggccaggtttgtgctggtgggctctggcaaccccgaagaa
ggcgagctcaggccccaactgctcgatcggttcgggatgcacgccgagatccgcaccgtc
aaagaaccagaactgcgggtcaagatcgtagaacaacgcaccgagttcgatcgggaaccc
catgagtttatcgatcactaccaaaccgagcaggttgatttacaaaagaagatcgtcacc
gcccaggaaaacctcaacgccgtaggcattccccatgagttgcgcctgcacatttcccag
gtttgtgcccagctagacgtagacgggttgcgcggtgatattgttaccaatcgcgctgcg
aaggctctggctgcgtttgagggtaagtcagaggtggatgtggatgaaattaaacgggtg
atcacgctctgtttgcggcatcgcctgcggaaagacccgctcgaatcgatcgattctggc
tataaggtgcagaaggtcttcgctgaggtctttggcttagcggaagcagaataa

DBGET integrated database retrieval system