KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2758Help
Entry
Pse7367_2758      CDS       T02369                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase, Formamidopyrimidine-DNA glycosylase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:pseu03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3473535..3474500)
Genome map
AA seq 321 aa AA seqDB search
MPELPEVETVRVGLSKNTIGRSIAATEVILERMVAAPNNPAEFAKALQGAIFQGWQRRGK
YLLAKLSDHKGSDRGWLGVHLRMTGQMLMVDRHEPIHSHTRIRLFLDRLNGQAKSPRLRD
SGAGSDPRSPQINKSLDSLEQELRFADQRTFGRMWWVPPGVEPEQVITGLQLLGVEPLLA
DYSRNPKLSAAYLTKRLSKSNRAIKTALLDQAIVAGIGNIYADETLFLSKIHPEQKALSL
TKAQIKRLPDAIAKSLQAGIAHGGTTFSNFQDVAGDKGNYIYSAWVFRRQGQPCRVCNTT
IERIKVGGRSTHFCPKCQSSP
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattaccggaagtagagaccgttagagttggtctgagtaaaaacacgatcggc
cgatcgatcgccgctacggaagtgatcctagaacggatggtggctgcacccaataatccg
gctgaatttgccaaggcattgcagggggcgatctttcagggttggcagcgacggggcaaa
tatttattagcaaaactaagtgatcataagggcagcgatcgtggttggctaggggtgcat
ctacgcatgactggccaaatgctcatggtcgatcggcacgaaccgatccatagccataca
cgaatccgtttatttctcgatcgtttaaatggtcaagctaaaagcccacgtctgagggat
tctggggctggttctgatccgcgatcgccgcaaataaataaatctctagactctctagag
caagaacttagattcgccgatcagcgcacctttggtcgaatgtggtgggtgccgccagga
gttgaaccagaacaggtgattacggggctgcaattgctgggcgttgagcctttgttggct
gattattcacgtaatcccaagctatcagccgcttacctgaccaaacgcctgagcaagagc
aatcgcgcgatcaaaactgccctgctcgatcaggcgatcgtagctgggattggtaatatc
tatgccgatgaaactttgtttttgagtaaaatccatcccgaacagaaggcactgagttta
accaaagcgcagattaaacgattacccgatgcgatcgctaagtcattgcaagctgggatc
gcccacggtggtacgacgtttagtaattttcaggatgtggctggagataaaggtaattat
atttactcggcctgggtgtttcgccgtcagggtcaaccttgccgagtttgcaacaccacg
atcgaacggatcaaagtgggcgggcgatcgacgcatttttgccctaaatgccaatcttca
ccttaa

DBGET integrated database retrieval system