KEGG   Pseudanabaena sp. PCC 7367: Pse7367_2833Help
Entry
Pse7367_2833      CDS       T02369                                 

Definition
glutathione S-transferase domain-containing protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pseu00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3569865..3570542)
Genome map
AA seq 225 aa AA seqDB search
MLLLQFSTSHYCRKARLALGYKRIPYRVQNLTPGVHILKLKPLTGLTTVPVLLPELPDQP
EAIADSSRIMAFLDRFQPEPSLMPDDSKLQTKALSLEDWFDESIGTATRFIYYQFRANEG
KYIDNSLTSQILIQVVRRQLGINGATVALAEARLQIALAKLAQRWPEHDFLIGDRLSRAD
LAAAALLSPLALIPKYQKEYAWLFEKIAAVHQICGEALPPGLNTH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgctactgctgcaatttagcacttctcattattgccgcaaggcgagattagccctggga
tataagcgtattccttatcgggttcagaacctcacccctggtgtgcatatcctgaagcta
aaaccgctgactggtttaaccacggtgcctgtattattaccagagttgccagatcagcca
gaggcgatcgctgattccagtcggattatggcttttctcgatcgctttcaaccagagcct
agcctgatgcccgatgattctaagttacaaactaaagccctgtccttagaggattggttt
gatgagagcattggtacggcgacgcggtttatttattatcaatttcgagccaatgagggc
aaatatatagataattcgctcaccagccagattttaattcaagtggtgcggcggcaactg
ggcattaatggcgcaactgtagccctggcggaagcacgcttgcagattgctttggcaaag
ttagcgcagcgctggccagaacatgatttcttgattggcgatcggctcagtcgggctgat
cttgcggcggcggctttgctgagtcctttggctttgattcccaaatatcaaaaagaatat
gcctggttatttgaaaagattgcagcggtgcatcaaatttgtggggaggcgcttccacct
ggtttaaatacccattaa

DBGET integrated database retrieval system