KEGG   Pseudanabaena sp. PCC 7367: Pse7367_3365Help
Entry
Pse7367_3365      CDS       T02369                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:pseu00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pse7367_3365
Enzymes [BR:pseu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pse7367_3365
Two-component system [BR:pseu02022]
 CheA family
  WspE-WspRF [MD:M00509]
   Pse7367_3365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4200814..4201857
Genome map
AA seq 347 aa AA seqDB search
MLKIAIVNDTMIAIEAMRRVIATIADYQIVWIARDGSEAVAKCASSCPDLILMDLHMPKM
DGVAATRQIMQQSPCSILIVTATVHANTAKVFEAMGYGALDVVRTPILGLQGQPAVAPDL
LHKIATIAKLIGKSRSSKPNNPNLPNRSPLAVPRSAGQLPPLIAIGASTGGPNALASILS
ELPQNFEAAIVVVQHIDAQFTPGLGQWLNQQTPLTVELAIAGTQPTAGKVLLAATNEHLV
LKSDRRLYYTKQPSHYIHCPSVDVLFSSLAQHWTRAGIGLLLTGMGKDGAEGLSLLRRSG
WHTIAQDQASCVVYGMPKAAIEAGAAVEVLPIEAIGAVLRNRKVITP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaattgccattgtgaacgataccatgattgcgatcgaagcgatgcgccgcgtc
attgccacgattgccgattatcaaattgtttggatcgcccgtgatggcagcgaagcggtt
gctaaatgtgctagctcctgcccagatttaatcttgatggatttgcatatgcccaaaatg
gatggggtcgccgccacccgccaaatcatgcaacaaagcccctgctcaatcctgattgtg
actgccacggttcatgccaataccgccaaggtgtttgaggctatggggtatggtgcttta
gatgtagtgcgaacgccgatcttgggtctgcaagggcaacccgccgtcgctccagatctg
ctgcataaaatcgccacgatcgctaaactgattggcaaatcacgcagctccaagcctaac
aatccaaatctgcccaaccgatcgccgcttgctgtacctcgcagcgctgggcaactgccc
cctttaattgcgattggcgcatccactggcggccccaatgccctggcaagtattttgtct
gagctaccccagaattttgaagcggcgatcgtggtggttcagcatatcgatgcccaattt
acacccggtttggggcaatggctaaatcagcaaacgcctttaaccgtggaattggcgatc
gctggcactcaacccaccgccggcaaagtattattagcagcaaccaacgaacatttggtg
ctcaagtccgatcgtcggctttactataccaagcaacccagccactatattcattgtcca
tcggtggatgtattgtttagcagcctggcccagcactggaccagagcaggaataggcctg
ttgctcactggtatgggcaaggatggggccgaagggttaagtttattacgtcgatctgga
tggcacacgatcgcccaagatcaagctagttgtgtggtttatggcatgcccaaagcagcg
atcgaggcgggggcagccgttgaagttctaccaatcgaggcgatcggcgctgtcctacgc
aaccgaaaagtcatcaccccttaa

DBGET integrated database retrieval system