KEGG   Pseudanabaena sp. PCC 7367: Pse7367_3566Help
Entry
Pse7367_3566      CDS       T02369                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pseu00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4455418..4456278)
Genome map
AA seq 286 aa AA seqDB search
MSQVRVPEAFQNENKYKYCITLIIKSKNLKMTTSYRQSKFINPDQDPNRDLTSFTAKENG
SVGKPISKVIRERLKSLGVKYFANDSIAEYISDGEREELKLEIEDKLQGLFDALVIDTDN
DHNTHETAFRMAKMYVDEVFKGRYHPMPKVTDFPNAKALDEIYVLGPISVRSACSHHFVP
IIGHAWLGIVPSDRVIGISKFNRIVDWVLSRPHIQEEAAVMVADTIERLIQPRGLAFVIK
AQHMCMSWRGVKEPETQMTNSIVRGTFREDPTAKKEFFDLIRGHGF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaggtgcgcgttcctgaggcgtttcagaatgagaataagtataaatattgtatt
acgttaataattaaatctaagaacctaaaaatgaccactagttatcgtcaatctaagttc
atcaacccagaccaagatcccaatcgtgatctaaccagctttacggctaaagagaatgga
agtgttggtaagccaatttccaaagtaatccgggaacggctcaagtcccttggcgtgaag
tattttgccaatgacagcattgctgaatatattagcgatggtgaaagagaagagttaaag
ctggagatcgaggataagctgcaagggttgtttgatgcgctagtaattgacactgataac
gatcacaatacccatgagactgcctttcggatggcaaaaatgtacgtggatgaggtattc
aagggtcgctatcacccgatgccgaaggtaacggatttccccaatgccaaagcactcgac
gagatttatgtattaggcccgatctcagtgcgttccgcttgctcccatcactttgtgcca
attattggccatgcctggttggggattgtgcctagcgatcgggtaataggtatttccaag
ttcaatcggattgtggattgggtgctcagccgtccccacattcaagaagaagcggcggtg
atggtggccgatacgatcgaaagattgattcagccccgtggtttggcctttgtaatcaag
gcacaacatatgtgcatgagctggcgcggcgtaaaagagccggaaacccagatgaccaac
tcgatcgtgcgcggcaccttccgcgaagacccaactgctaagaaggaattctttgatctt
attcgcggtcatggcttttaa

DBGET integrated database retrieval system