KEGG   Pseudanabaena sp. PCC 7367: Pse7367_3598Help
Entry
Pse7367_3598      CDS       T02369                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pseu  Pseudanabaena sp. PCC 7367
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:pseu00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4493757..4494704
Genome map
AA seq 315 aa AA seqDB search
MSKSLSLKAPAKINFYLQITGNRPDGYHDLVMIMQSVDLSDRVDLRQTASEAIVVHCDHP
QVPQDRTNLADRAAHLMQQRFPSVGGIEIKIHKNIPIAAGLAGGSTDAAAVLVGIDRLWQ
LGLTQPELRELAAQLGSDIPFCISGGTALATGRGEVITPVADLADVAIVICKPKDIAIST
AWAYQTFRAAGLLAQGKQLQPSHDRSSEMLAVLEAAKDKHNQALIEVATQLGQLLYNDLE
RVVLPAHPAIVQLKQQLQAQAPLGVLMSGSGATVFAIARDLEHARQIAKSVVAGLPNIEA
WVTKTIGNGIQDFLD
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagagcctttctttgaaagccccagccaaaattaatttctatttgcaaatcact
ggcaatcgcccggatggttatcatgatctggtgatgattatgcaaagcgtggatctaagc
gatcgtgtggatttgcgccagaccgccagtgaagcgatcgtggtgcattgcgatcatccc
caagtcccccaggatcgcaccaacttggccgatcgggctgcccacttaatgcagcaacgg
ttcccatctgtaggcggcatagaaattaaaatccataaaaatattccgatcgcagcaggg
ctggcgggtggctcaaccgatgcagcggcagttttggtcgggatcgatcgcctgtggcaa
ctgggattaactcagccagagttacgcgaactggctgcccaactgggctcggatattcct
ttttgcatcagtggtggcacggccttggccactgggcgaggcgaggtgatcacgccagtt
gctgatctggcagatgtggcgatcgtgatttgcaaacccaaagatattgcgatttctacg
gcctgggcctatcaaacctttcgggcagcaggtctgctggcgcaaggtaagcaactgcaa
cctagccacgatcgctccagtgaaatgctggcggtgcttgaagcagccaaagacaaacat
aatcaagcattaatagaggtggcgacccaactggggcaattgctctataacgacctggag
cgagtagttttaccggctcatcccgcgatcgtgcagcttaagcaacaattgcaagcccaa
gcgccgctgggggtattaatgtctggctctggcgcaaccgtgtttgcgatcgcccgtgat
ttggaacatgccaggcagatcgctaagagcgtggttgctgggctaccgaatattgaagcc
tgggtgactaaaacgatcggtaatggcattcaggactttttggattaa

DBGET integrated database retrieval system