KEGG   Pseudovibrio sp. FO-BEG1: PSE_0040Help
Entry
PSE_0040          CDS       T01669                                 

Definition
Lipolytic enzyme, G-D-S-L family protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSE_0040
Enzymes [BR:psf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSE_0040
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSE_0040
Lipid biosynthesis proteins [BR:psf01004]
 Fatty acid synthase
  Component type
   PSE_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(42661..43341)
Genome map
AA seq 226 aa AA seqDB search
MSGSRKVEAKSGVLRFFSGAVVALGLALTSASAGMAQDGAEPVKLVAFGDSLTAGYQLPP
EDAFPVKLEKALQERGYNITIVNAGVSGDTTSGGLSRLDWSIGDDVDGVILELGANDALR
GLDPSTTRKNLDAMLARLSSRDIPVLLAGMMAPPNLGDQYGQEFNSIYGDLAEKHDALLY
PFFLDGVAAEPKLNLGDGMHPTGEGVSIIVEKILPSVEMLIDQTKS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtctggatcacgaaaagttgaagctaaatctggtgtgctacgttttttcagtggtgcc
gttgttgcgctgggccttgctcttacgagtgcttctgccggaatggcgcaggatggagct
gagccggtgaagttggttgcgtttggcgatagtctgaccgcaggctatcagttgccacct
gaagatgccttccctgtcaaactggaaaaagcgttgcaagagcggggctacaacatcacg
attgtgaacgctggtgtttctggtgataccacctccggcggcctttcccggttggactgg
tccatcggtgatgatgttgatggtgtgatcctggaactgggtgctaatgatgcgctgcgt
ggtctggatccctcaacaacccgcaagaaccttgatgcaatgctggctcgcttgagttcc
cgcgatattccggtgttgctcgccggtatgatggcgccgcctaatctgggggatcagtac
ggtcaggagttcaactccatttacggtgatctggctgaaaagcatgatgcgctgctttat
ccgttctttctggatggtgtggcagcagagccaaagctgaaccttggggatggcatgcac
ccgacgggtgagggcgtttcgatcattgtcgaaaagatcctgccttccgttgaaatgctc
atcgaccagactaaatcttga

DBGET integrated database retrieval system