KEGG   Pseudovibrio sp. FO-BEG1: PSE_0086Help
Entry
PSE_0086          CDS       T01669                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    PSE_0086
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    PSE_0086
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     PSE_0086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84625..85407
Genome map
AA seq 260 aa AA seqDB search
MLSGKTAVITGSTSGIGLAYARAMAEQGANIMINGFGDADAIEKERAGIESDFGVKCVYS
SADMTKPDEIHAMIHEAHKTLGSVDVLVNNAGIQHVEAIEHFPVEKWDAIIAINLSSAFH
TIRTAVPYMREAGWGRIINTASAHALVASPFKAAYVSAKHGIAGLTKTVALEVAENNITV
NAICPGYVWTPLVEKQIPDTMKARNMTEEQVKKEVLLAAQPTKEFVTVDQVAGLAVFLCS
DTAASITGTLLPIDGGWTAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctctcagggaaaaccgctgtaatcactggctccacttccggcatcggccttgcctat
gcccgtgcaatggcggagcaaggcgccaacatcatgatcaacggctttggggacgcggac
gcaatcgagaaagagcgcgcaggtatcgagtccgatttcggcgtgaaatgcgtttactct
tcagcagatatgaccaaacctgacgaaattcacgccatgatccacgaggcccacaaaacc
cttggctctgtcgatgttctcgtcaacaacgcaggtattcagcacgttgaagcgattgaa
catttcccggtcgaaaaatgggacgccatcatcgcgatcaacctgtcttccgcattccac
accatccgcacggcagtgccttacatgcgcgaagcaggctggggccgtatcatcaacacc
gcctccgcacatgctctcgtcgcgtctccgttcaaggcagcttacgtctcagccaaacac
ggcatcgcaggtctgaccaaaacagttgcgctggaagtggcagaaaacaacatcacagtg
aatgccatctgcccgggctatgtctggacccctctcgtcgaaaagcagatcccagacact
atgaaagcacgcaatatgactgaggagcaggtgaaaaaggaagtcctgctggccgctcag
ccaaccaaagagttcgtaacagtagatcaggttgctggtcttgccgtgttcttgtgctct
gatacggcagcttcaatcactggcacattgttgccaatcgatggtggctggacagctcaa
taa

DBGET integrated database retrieval system