KEGG   Pseudovibrio sp. FO-BEG1: PSE_0100Help
Entry
PSE_0100          CDS       T01669                                 

Gene name
ccpR
Definition
Cytochrome c551 peroxidase (Cytochrome c peroxidase) (CCP)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     PSE_0100 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(95962..97038)
Genome map
AA seq 358 aa AA seqDB search
MEEFMRAIIKTLIGASVLSLAAQGGALAQSELLEEARTYFKPIPHAVPAVKGNTITREKI
DLGRKLFFDPRLSLSGLLSCNSCHNLGMGGDDNLETSIGHGWQKGPRNAPTVLNAVFNLA
QFWDGRAEDLKEQAKGPVQAGVEMASTPERVEAVLNSMPGYTEQFARAFPGEEKATNFDN
MAKAIEAYEATLITPASKFDLFLEGNENALSAQEKQGLQAFMDTGCAACHGGVNIGGEGY
YPFGVVEKPGADVLPVNDKGRFAVTQTAEEEYVFRASPLRNIELTAPYFHSGKVWDLKQA
VAIMASSQLGAELTDEDIDAITAFLKTLTGEQPVVEYPILPVRTDSTPLPDPSVMTAH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggaggaattcatgcgagccataattaagacattgattggcgcatctgttctcagcttg
gctgctcagggaggagccttggctcagtctgagttgttggaagaggcgcgcacttacttc
aagccgatcccgcacgctgtacctgctgtaaaaggcaacacaatcacccgcgaaaaaatc
gatctggggcgcaagctgttttttgatccgcggctatcgctctctggtttgttgtcgtgc
aacagttgtcacaaccttggcatgggtggggatgacaatctggaaacatccatcggccat
ggatggcagaaggggccgcgcaatgcgcctaccgttctgaatgctgtgttcaaccttgct
cagttctgggatggtcgtgctgaagacctgaaggagcaggcaaaaggccctgtgcaggct
ggtgttgaaatggccagtacgccagagcgggttgaagctgtgctgaacagtatgcctggc
tacaccgagcagtttgcaagagcattccccggtgaagaaaaagcgacgaacttcgacaat
atggcgaaggctatcgaagcttatgaggcaactctgatcacgcctgcgtccaagtttgac
ctgttccttgagggcaatgaaaacgcgctcagtgctcaggaaaagcagggacttcaggca
tttatggacaccggctgtgccgcttgtcatggcggcgtgaacattggtggtgaagggtac
tatccattcggcgtggttgagaaacctggtgctgatgttctgcctgtaaacgacaaaggc
cgctttgctgtcactcaaaccgctgaggaagagtacgttttccgtgcatctccactgcgt
aacatcgagctgacggccccttatttccattccggtaaagtttgggatctgaaacaggcc
gttgccattatggcaagttctcagctgggtgctgaactgactgatgaagatattgatgcg
atcactgcattcctgaagacccttacaggtgagcagccggttgttgagtatccgatcctt
ccggttcggacagattctacaccactccctgatccgtctgtcatgacggctcactaa

DBGET integrated database retrieval system