KEGG   Pseudovibrio sp. FO-BEG1: PSE_0133Help
Entry
PSE_0133          CDS       T01669                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSE_0133 (folK)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     PSE_0133 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(135067..135558)
Genome map
AA seq 163 aa AA seqDB search
MTQEKIVAALGLGSNLGDTKANIDGAVAALNAVEGISVLKKSSDYRTPPWGPVPQDDYRN
CCITVETVLSPRDLLNAGLDIEKQLGRVRDVRWGPRTIDIDLLIYDHASVEEEGLQVPHP
RMGERAFVLIPLTEIWPEAPLLDGRTAAEALETCADKEGIYKL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgacacaagaaaagattgttgcagcacttggtttgggctcaaatcttggcgataccaaa
gcgaatatcgacggtgcagtggccgcattgaatgctgtcgagggaatatctgttttaaaa
aagtcgtccgactatcgcacaccgccgtgggggcctgtgccgcaggatgactaccgcaac
tgttgcattaccgtggagacggttctgtctccgcgtgacctgctgaatgcgggtctggat
atcgaaaagcagcttggccgtgtgcgtgatgtgcgctgggggccgcggacgatcgatatc
gacctgctcatctatgatcacgcaagcgttgaggaagagggacttcaggttccacaccca
cgcatgggcgagcgtgcgttcgtgcttattccgctgaccgagatctggccggaagcacct
ttgctggatggacgcacggcagctgaagcgctggaaacctgcgctgataaggaaggcatc
tacaagctgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system