KEGG   Pseudovibrio sp. FO-BEG1: PSE_0134Help
Entry
PSE_0134          CDS       T01669                                 

Gene name
folP
Definition
Dihydropteroate synthase (DHPS)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(135558..136379)
Genome map
AA seq 273 aa AA seqDB search
MAEFDHRVLESSQRPLVMGILNVTPDSFSDGGQFDAPAAALAHAIEMIAEGADIIDVGGE
STRPGATVVEELDELERVLPVLDLIKELPVLISIDTYKAKVAAAACKAGAHIVNDVWGLQ
KDPDMAGVVADAGVPVIMMHNRTEVDEQLDIMADIERFFEKSLKLATDAGIPEEYQILDP
GFGFGKTLQQNYQILNRLSELRKFNRPILAGASRKRMIGYVLNNEAPERMAGSLAVHTLS
LQHGAQILRVHDVKPHADAVRIFQAMKELGSSQ
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atggcagagtttgatcatcgagtgctggaaagctctcagcggccgcttgtcatgggcatc
ttgaacgtgaccccggatagcttttctgatggtgggcagttcgatgcgcccgctgctgcg
cttgcgcatgcgattgagatgatcgccgaaggggcggatatcatcgatgttggcggcgaa
agcacgcggcccggtgcgactgtggttgaagagctggatgagctggagcgggttctgccg
gtgctggatctcatcaaagagctgccggttctgatttccatcgacacctataaggccaag
gttgcagcagcggcctgcaaggctggcgcgcatatcgtcaatgatgtttggggcttgcag
aaagaccctgacatggctggtgtggtggcggatgctggtgtgcctgtcattatgatgcat
aaccgcaccgaggttgatgagcagctggacatcatggctgacatcgagcgcttcttcgaa
aaatcactcaagctggccacagatgctggcattccggaagagtatcagatcctcgatccg
ggctttggctttggcaaaacccttcagcagaactatcagatcctgaaccggctttctgag
cttcgtaagtttaaccgcccaatccttgcgggggcatctcgcaaacgtatgattggatat
gtgttgaataatgaagcgccagagcgtatggctggatcgcttgcagtccacacgctttcg
ctacaacacggagcgcaaattctgcgagtgcatgatgtgaagccgcatgctgatgctgtg
cggatcttccaagcaatgaaagaactaggcagcagccaataa

DBGET integrated database retrieval system