KEGG   Pseudovibrio sp. FO-BEG1: PSE_0527Help
Entry
PSE_0527          CDS       T01669                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSE_0527
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSE_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
551963..552511
Genome map
AA seq 182 aa AA seqDB search
MNSFELNKIAGAILFALVAFMGLNVLSDIIFAPHGDEKRGFEIEVAGADNGAGEEAAEET
KVVSIEELLATADADAGAKQAKKCAACHTFDQNGKNKVGPALWGIVGRAPASHGGFSYSA
AMQEFAANNPEWTFEQLNEFIKAPKKHVAGTSMGYAGLKKDKPRADLIAYLRSLSDNPVP
IN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgtttgaactgaacaaaattgccggcgcaattctgttcgctttggttgcattc
atgggcctgaatgttttgtcagacattattttcgcgcctcatggagacgaaaaacgcggt
tttgaaatcgaagtagctggtgccgacaacggtgcaggtgaagaagctgcggaagaaacc
aaggttgtctcaattgaggaactgctcgcaactgctgatgcggatgctggtgcaaagcaa
gctaagaagtgtgcagcgtgtcacacctttgatcagaacggcaaaaacaaagttggccct
gctctctggggtatcgtaggccgcgcgcctgcctctcacggtggtttctcttactctgca
gcaatgcaggagttcgcagcaaacaatcctgagtggactttcgagcagctgaacgagttc
atcaaagcgcctaagaaacacgttgctggtacttccatgggttacgctggtctgaaaaaa
gacaagccacgtgctgatctgatcgcttacctgcgttcactctcagacaacccagtgcca
atcaattaa

DBGET integrated database retrieval system