KEGG   Pseudovibrio sp. FO-BEG1: PSE_0527Help
Entry
PSE_0527          CDS       T01669                                 

Definition
(GenBank) cytochrome c, class I
  KO
K08738  cytochrome c
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf01100  Metabolic pathways
psf01120  Microbial metabolism in diverse environments
psf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSE_0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AEV35039
UniProt: G8PLZ7
Position
551963..552511
Genome map
AA seq 182 aa AA seqDB search
MNSFELNKIAGAILFALVAFMGLNVLSDIIFAPHGDEKRGFEIEVAGADNGAGEEAAEET
KVVSIEELLATADADAGAKQAKKCAACHTFDQNGKNKVGPALWGIVGRAPASHGGFSYSA
AMQEFAANNPEWTFEQLNEFIKAPKKHVAGTSMGYAGLKKDKPRADLIAYLRSLSDNPVP
IN
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaactcgtttgaactgaacaaaattgccggcgcaattctgttcgctttggttgcattc
atgggcctgaatgttttgtcagacattattttcgcgcctcatggagacgaaaaacgcggt
tttgaaatcgaagtagctggtgccgacaacggtgcaggtgaagaagctgcggaagaaacc
aaggttgtctcaattgaggaactgctcgcaactgctgatgcggatgctggtgcaaagcaa
gctaagaagtgtgcagcgtgtcacacctttgatcagaacggcaaaaacaaagttggccct
gctctctggggtatcgtaggccgcgcgcctgcctctcacggtggtttctcttactctgca
gcaatgcaggagttcgcagcaaacaatcctgagtggactttcgagcagctgaacgagttc
atcaaagcgcctaagaaacacgttgctggtacttccatgggttacgctggtctgaaaaaa
gacaagccacgtgctgatctgatcgcttacctgcgttcactctcagacaacccagtgcca
atcaattaa

DBGET integrated database retrieval system