KEGG   Pseudovibrio sp. FO-BEG1: PSE_0594Help
Entry
PSE_0594          CDS       T01669                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:psf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616023..616634)
Genome map
AA seq 203 aa AA seqDB search
MSTRRVAGPEIERLIQLLAKLPGLGPRSARRAALHLVQKKDQLLIPLAEAMGVAVDQVGI
CSECGTVDTSDPCTICSDPRRDGSTIVVVEDVSDLWALERASAVSAHYHVLGGTLSPLDG
IGPDDLNISKLMERVESGGVNEVILAVNATVEGQTTAHFITDQLARFENVKVTRLAHGVP
VGGELDYLDEGTLAQALRARTKF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacgcagggttgctggtcccgaaattgaacgcctgattcagctgcttgccaag
ttgcccggccttggtccacgctcggccagacgcgccgctttgcatctggttcagaagaaa
gatcagttacttatccctctggcggaagccatgggcgtggctgttgatcaggttggcatc
tgctcagaatgcggcaccgttgataccagtgatccttgcaccatttgctctgatccgcgc
cgggatggctccaccattgtggtggttgaggacgtctctgacctttgggcgctggagcgg
gcatcggcagtgagcgcgcattatcatgtcctcggtggcaccttgtctccgctggatgga
attgggccggatgacctcaatatttccaagctgatggagcgtgttgaaagcggcggtgtg
aacgaagttatcctcgcggtgaatgccaccgttgaaggacagaccacagcgcatttcatt
acggatcagcttgcgcgatttgagaatgtgaaagtgacccgccttgcccatggtgtgccg
gttggtggggaactggactaccttgacgaaggcactctggcgcaggctttgcgagcaaga
acaaagttttag

DBGET integrated database retrieval system