KEGG   Pseudovibrio sp. FO-BEG1: PSE_0594Help
Entry
PSE_0594          CDS       T01669                                 

Gene name
recR
Definition
Recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:psf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSE_0594 (recR)
DNA repair and recombination proteins [BR:psf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSE_0594 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(616023..616634)
Genome map
AA seq 203 aa AA seqDB search
MSTRRVAGPEIERLIQLLAKLPGLGPRSARRAALHLVQKKDQLLIPLAEAMGVAVDQVGI
CSECGTVDTSDPCTICSDPRRDGSTIVVVEDVSDLWALERASAVSAHYHVLGGTLSPLDG
IGPDDLNISKLMERVESGGVNEVILAVNATVEGQTTAHFITDQLARFENVKVTRLAHGVP
VGGELDYLDEGTLAQALRARTKF
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacgcagggttgctggtcccgaaattgaacgcctgattcagctgcttgccaag
ttgcccggccttggtccacgctcggccagacgcgccgctttgcatctggttcagaagaaa
gatcagttacttatccctctggcggaagccatgggcgtggctgttgatcaggttggcatc
tgctcagaatgcggcaccgttgataccagtgatccttgcaccatttgctctgatccgcgc
cgggatggctccaccattgtggtggttgaggacgtctctgacctttgggcgctggagcgg
gcatcggcagtgagcgcgcattatcatgtcctcggtggcaccttgtctccgctggatgga
attgggccggatgacctcaatatttccaagctgatggagcgtgttgaaagcggcggtgtg
aacgaagttatcctcgcggtgaatgccaccgttgaaggacagaccacagcgcatttcatt
acggatcagcttgcgcgatttgagaatgtgaaagtgacccgccttgcccatggtgtgccg
gttggtggggaactggactaccttgacgaaggcactctggcgcaggctttgcgagcaaga
acaaagttttag

DBGET integrated database retrieval system