KEGG   Pseudovibrio sp. FO-BEG1: PSE_0615Help
Entry
PSE_0615          CDS       T01669                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSE_0615 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSE_0615 (sucC)
   00640 Propanoate metabolism
    PSE_0615 (sucC)
   00660 C5-Branched dibasic acid metabolism
    PSE_0615 (sucC)
Enzymes [BR:psf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PSE_0615 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
635612..636817
Genome map
AA seq 401 aa AA seqDB search
MQMNIHEYQAKAVLKEYGAPVAEGVAIFSADEAKAAADKLPGPLWVVKSQIHAGGRGKGK
FKELGPDAKGGVRLAFSKDEVESHANEMLGNTLVTAQTGDAGKVVNRLYIEDGADIDREL
YLSLLVDRTCGQVAFVASTEGGMDIEEVAHATPEKILTLPINPLEGVTEEKASALCDTLK
LEGEAREDGMKLFPILYKAFVEKDMALLEINPLIVMENGRLRVLDAKVSFDGNALFRHED
IVALRDKTEEDEKEIEASKHDLAYVALDGNIGCMVNGAGLAMATMDIIKLYGAEPANFLD
VGGGATKEKVTSAFKIITSDPNVQGILVNIFGGIMRCDVIAEGVLAAVKEVGLQVPLVVR
LEGTNVELGKKIINESGMNVIPADDLDDAAQKIVAAVKEVA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtgcagatgaacattcatgagtatcaggctaaagcagtcctgaaagaatacggcgcaccg
gttgctgaaggtgtcgcaattttctccgcagacgaagcaaaagctgcggcagataaactt
cctggcccgctttgggttgtgaagtcccagatccacgccggtggccgtggtaaaggtaag
ttcaaggaactcggcccagacgcaaagggcggcgttcgcttggcattcagcaaggacgaa
gttgagtcccacgcgaatgagatgcttggcaacaccctcgtaaccgctcaaaccggtgac
gcaggcaaagttgtaaaccgtctttacattgaagacggcgcagacatcgatcgcgaactg
tatctctcccttctggtagaccgtacttgtggtcaggttgctttcgtagcatccaccgaa
ggcggcatggacatcgaagaagttgcacacgcaactcctgaaaagatcctcaccctgcca
atcaatccattggaaggtgtgactgaagagaaggcttctgcgctttgcgacaccctcaag
cttgaaggtgaagcacgcgaagacggcatgaagctgttcccgatcctctacaaagcattt
gtagaaaaggatatggcgcttctcgaaatcaacccgctgatcgtcatggaaaacggtcgt
ctgcgcgttctggatgcgaaagtatccttcgacggcaacgcactgttccgccacgaagac
atcgttgctctgcgcgataaaaccgaagaagacgaaaaagagatcgaagcttccaagcac
gacctcgcttacgttgctcttgacggtaacatcggctgcatggtgaacggtgctggtctc
gcaatggcgaccatggacatcattaagctgtatggtgctgagcctgcaaacttcctcgac
gttggtggcggcgctaccaaagagaaagtaacctctgcgtttaagatcatcacatctgat
ccaaacgtacagggcattctggttaacatcttcggcggcatcatgcgctgtgacgttatc
gcagaaggcgtgctggctgctgttaaagaagttggcctgcaggttccactcgttgtgcgt
cttgaaggcaccaacgttgagcttggcaaaaagatcatcaacgagagcggcatgaatgtt
attcctgctgacgatctcgatgacgcagctcagaaaatcgtagctgctgtgaaggaggtc
gcataa

DBGET integrated database retrieval system