KEGG   Pseudovibrio sp. FO-BEG1: PSE_0618Help
Entry
PSE_0618          CDS       T01669                                 

Gene name
sucB
Definition
Dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSE_0618 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSE_0618 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSE_0618 (sucB)
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSE_0618 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
640962..642479
Genome map
AA seq 505 aa AA seqDB search
MATEIRVPTLGESVTEATIAQWFKKPGDAVNADEPIVELETDKVTVEVPAPVAGKLESID
VKEGDTVEVGALLGAIAEGAAGAAAAPAAKAEPAASAAPAAAAETIEVLVPSAGESVTEA
EVGEWSVKVGDVVKADDILVELETDKAAQEVPSPVAGTVVEIAQATGATVEPGNLLCKIA
KGEGAAVAAAAAQAAAAPAPAVSGSSMPPAPSAAKMMAEKGLSADQVAGSGKRGQVLKGD
VLAAVAAGVTAAPAAAAAPAPVAVRAPSAPADEVREERVRMTKLRQTIARRLKDAQNTAA
MLTTYNEVDMKPIMDLRKQYKDIFEKKHGVKLGFMGFFTKAVTHALKEIPAVNAEIDGTD
IIYKNFAHIGVAVGTPKGLVVPVVRDADQMSIAEIEKEIGNLGRKGRDGKLSMADMQGGT
FTISNGGVYGSLMSSPILNAPQSGILGMHKIQERPVAINGQVEIRPMMYLALSYDHRIVD
GKEAVTFLVRVKESLEDPQRLVLDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaaattcgagtacccactctgggtgaatccgtaaccgaggcaacaatcgct
caatggttcaaaaaaccgggcgatgcggtgaatgcagacgaaccaatcgttgagctggaa
acagacaaggtaactgttgaagtgcctgctcctgttgctggcaagctggaaagcatcgac
gtgaaagaaggcgacactgtagaagttggcgcacttcttggcgcgatcgctgaaggcgct
gctggcgcagcagctgctccagcagctaaggctgaaccggctgcatctgcagcacctgct
gccgctgctgagacaattgaagttctcgtaccttctgctggtgaaagtgtcaccgaagct
gaagttggcgagtggtccgtgaaggtgggtgatgttgtcaaagcagacgacattctcgtt
gaactggaaactgacaaagctgctcaggaagtacctagcccagttgctggtactgttgtt
gagattgctcaggcaactggcgcaactgttgagccaggcaacctgctctgcaagatcgct
aaaggcgaaggcgcagcagttgctgctgcagcagctcaggctgccgctgctcctgcacca
gcagtatccggttccagcatgcctcctgcaccatctgcagcgaaaatgatggctgaaaaa
ggcctctccgctgatcaggttgcaggctccggcaagcgcggtcaggttctcaaaggtgat
gttctcgcagctgtagctgctggcgtaaccgctgctcctgcagcagctgctgcaccggct
cctgttgctgttcgcgcaccatctgctccggctgatgaagttcgtgaagaacgtgttcgc
atgaccaagctgcgccagaccattgcgcgtcgcctgaaagatgctcaaaacaccgcggct
atgctgaccacttacaacgaagtggacatgaagccgatcatggatctgcgcaagcagtac
aaggacatcttcgagaagaagcacggcgttaagctcggctttatgggtttcttcaccaaa
gcagtgacccacgctctcaaagaaatcccagctgtaaacgctgagatcgatggcaccgac
atcatctacaagaacttcgcacacatcggcgttgctgttggcacaccgaagggtctcgtt
gttcctgtggttcgcgatgctgaccagatgtccatcgctgagatcgaaaaagagattggc
aacctcggccgcaaaggtcgtgacggcaagctctccatggcagacatgcagggtggcacc
ttcaccatctccaacggtggtgtttacggttccctgatgtcctctccaatcctgaatgca
ccgcagtccggtatcctcggcatgcacaaaattcaggagcgtccggttgcaatcaacggt
caggtcgaaatccgtccgatgatgtacctagctctgtcctacgatcaccgtatcgttgac
ggcaaagaggcagtgaccttcctggttcgcgttaaagagagccttgaagatccacagcgt
ctggttctggacctctaa

DBGET integrated database retrieval system