KEGG   Pseudovibrio sp. FO-BEG1: PSE_0899Help
Entry
PSE_0899          CDS       T01669                                 

Definition
glycoside hydrolase, family 42
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:psf00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939761..941731
Genome map
AA seq 656 aa AA seqDB search
MLELGTCYYPEQWPEELWADDARRMVELGLTWVRVAEFSWALVEREEGVFDWAWLDKAVS
ILGEAGLQIVMCTPTAAPPRWLIDKHPEILPVDENGVTRKFGARRHYCFSSPIYLEYAAK
IAEAFAKRYGKNQHVKAWQIDNEYGDHDTIYSYSPAAKQAFSHWLQQQYGSIEALNEAWG
TCFWGMHYTSFEQVELPNNLVEEPSPTHLLDFYRFSSDQVVLFNRTQVDVLRKHVGNTPI
THNFMGHNTDYDHYAVGNDIDFASWDSYPMGALVNAPKDDAEKARLLRVGLPDQPTFNHD
LYCHVGKGKAWVMEQQPGPVNWAIHNQSPQDGMIRLWTWLAYAHGIDVVCYFRWRQSKFA
QEQFHTGLLLPNNEPDQAFWEVAQVAKECASLPETGARQKAQVALVLDYPSRWAAHTLPQ
GADYSSAKVAMDWYATFSQFGVDIDIIGPHSDLTGYKLIILPDMIIDDPEFASRLKDAEV
KVFLGPRTGSKTKHMHVAEPLPPGSFKALIDLNVVRVESLPPYNQDQIFFDGHLGEVTNW
RESLKSSETVLASFQSDYRDGQPALVGNAKCIYAAAHFDGEFQKKLAEYLVNWVDVEPHA
GAQEGLRITQRGHLKFAFNFTSEVRKIELGSSVKTFVGGEQIPPFGVVIWSDEPDG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgttggagttggggacttgctattatccggagcaatggccagaggagctatgggcggat
gatgcgcgtaggatggttgagttggggctcacatgggtacgtgttgcggagttctcatgg
gctcttgtcgagcgggaagagggcgtgtttgactgggcgtggttggataaagccgtcagc
atcctcggcgaagcgggtttgcagattgttatgtgcacaccaacagcagcgcctcccaga
tggctgattgataagcatcctgaaattctgccggttgatgagaacggagtgacacgcaag
tttggtgcgcgacgtcattactgcttttccagcccaatctatcttgagtacgcagcaaaa
attgcagaagcctttgcaaagagatatggcaagaaccaacacgtcaaagcctggcagatt
gataacgagtacggcgaccacgacacgatctacagctactcacccgcagcaaaacaggct
ttcagtcactggctccagcagcagtatggctcgatcgaagccctgaacgaagcgtgggga
acgtgcttctggggtatgcattacacctcatttgagcaggtggagttacccaataatctc
gttgaagagccgagcccaacccatctgctggacttctatcgcttctcgtctgatcaggtg
gtgctgttcaatcgcactcaggtggatgtgctacgaaagcatgtcgggaatacgccgatt
acccataacttcatggggcacaacacggactacgatcactacgctgttggcaatgatatc
gactttgcctcctgggatagctaccccatgggcgcactggtcaatgctcctaaggatgac
gctgaaaaagcacgtcttttgagggtaggactaccagatcaaccgactttcaaccatgat
ctttattgccatgtgggcaaaggaaaagcctgggtgatggagcagcagccagggccggtg
aactgggcaatacacaatcaatcgccgcaggatggcatgatccgcctctggacatggttg
gcctatgctcatggcattgatgttgtctgttacttccgctggcgccaatccaaatttgcg
caggagcagttccatacaggcctgttgttgcccaacaatgaacctgatcaagcgttttgg
gaagtcgctcaggttgcgaaagaatgcgcatcactgcctgaaacaggagccagacaaaag
gcgcaggtagcactcgtgctggattatccgtctcgttgggcagctcatactttgcctcaa
ggagctgattactctagcgcgaaagtggcaatggactggtacgcaacgttttctcagttc
ggcgttgatattgatatcattggtccacactctgaccttacaggatataaactgatcatc
ctgcctgacatgatcattgatgatcccgagtttgcgtcacgcctgaaggatgctgaagtc
aaagtttttctgggaccaagaacgggcagtaaaacaaaacatatgcacgtggctgaacct
ctgccgccgggcagtttcaaagctctcattgatctgaatgtggttcgtgtggagtctctt
ccaccttacaatcaagatcagatcttctttgatggccatttgggtgaagtcaccaactgg
cgtgaaagcctgaagagttcagagactgttctggctagcttccagtctgactatcgtgac
ggccaaccggctttagttggtaacgcgaagtgcatctatgccgccgcgcattttgatggt
gagtttcagaaaaagctcgctgagtacctagtgaattgggttgatgtggagcctcacgcc
ggggcgcaggagggcttacgcatcacacagcgtgggcatctgaagtttgcgttcaatttc
accagtgaagtcagaaaaatcgagcttggaagctcagttaagacgtttgtggggggagag
cagataccaccgtttggcgtcgtaatctggtcggatgaaccagatgggtga

DBGET integrated database retrieval system