KEGG   Pseudovibrio sp. FO-BEG1: PSE_1032Help
Entry
PSE_1032          CDS       T01669                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00010  Glycolysis / Gluconeogenesis
psf00052  Galactose metabolism
psf00500  Starch and sucrose metabolism
psf00520  Amino sugar and nucleotide sugar metabolism
psf00521  Streptomycin biosynthesis
psf01100  Metabolic pathways
psf01110  Biosynthesis of secondary metabolites
psf01120  Microbial metabolism in diverse environments
psf01130  Biosynthesis of antibiotics
psf01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_1032 (glk)
   00052 Galactose metabolism
    PSE_1032 (glk)
   00500 Starch and sucrose metabolism
    PSE_1032 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_1032 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSE_1032 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PSE_1032 (glk)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSE_1032 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AEV35544
UniProt: G8PSB8
Position
complement(1083006..1084049)
Genome map
AA seq 347 aa AA seqDB search
MLHSAPLTRNLPYPVLVADIGGTNARFALIEGPNEPTKLCGQEGTKTHATIQDAIRAGVL
DQGYAAPRSAVLAVAAPVSSDRIALTNASWVIEPPALIKELGLEQVVILNDFEAQALALP
SLSPMDVDQVGGGEAVQNATKFVVGPGTGLGAGAMIRSCGKWIPVPGEGGHVELGPLSEE
EYRIWPYIERIGGRVGAEQVVCGAGLVRLAKAVLQADGVHRAYEKPSDVPMAAEDGDEVA
QKVLRLFCAALGRVAGDFAITNLARGGVYLAGGIPPKISHWLHGGEFRAAFEAKAPHEGI
MKSIPTYIITHKSPALEGLAAYTRAPDEYLVDLTGRSWHRKDTKIAE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctgcactctgctccgcttacaagaaacctaccctatccggtccttgtcgctgacatc
ggcggcacgaatgcccgctttgcgctgatcgaaggccctaatgagccgaccaaactttgt
ggtcaggaagggacgaaaacgcatgcgaccattcaggatgctattcgtgccggtgttctg
gaccaaggttatgctgctccacgctctgccgttctggctgttgcggctcctgtttccagc
gaccggattgcgttgaccaacgccagctgggtgattgagccacctgctcttattaaagag
ctcgggctggagcaggttgttattctcaatgactttgaagcacaggcgctcgctttgcct
tccctctcaccaatggatgttgatcaggtgggcggcggtgaagctgtccagaatgcgacc
aagtttgttgttgggccgggcaccgggctgggcgctggtgcgatgatccggtcttgcggc
aagtggattccggttccgggcgaaggcggccatgtggaacttggaccgctgagcgaagaa
gagtatcgcatctggccgtatatcgagcgcattggtggccgtgttggcgctgagcaggtt
gtttgtggcgctggactggttcgccttgccaaagccgttctgcaggccgacggtgtacac
cgcgcctacgagaagccatctgatgtgcctatggcagcagaggacggggatgaggttgcg
cagaaggtgttgcggctgttctgtgctgcacttggccgtgtggctggtgactttgctatc
accaatctggcgcgcggtggtgtgtatctggctggcggcattccgccgaagatctcgcat
tggctgcacggtggtgaattccgggctgcttttgaagccaaggcaccgcatgaaggcatc
atgaagtccattccgacttacatcatcacgcataagagcccagcccttgaaggccttgcg
gcttatacccgtgcgcctgatgagtatctggtggacctgacgggccgcagctggcaccgc
aaggacaccaagatcgcggaatag

DBGET integrated database retrieval system