KEGG   Pseudovibrio sp. FO-BEG1: PSE_1043Help
Entry
PSE_1043          CDS       T01669                                 

Gene name
pdp
Definition
pyrimidine-nucleoside phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSE_1043 (pdp)
Enzymes [BR:psf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PSE_1043 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1094315..1095631
Genome map
AA seq 438 aa AA seqDB search
MLPQEIVRKKREGEVLTAEEIQFFVKGITDNSVTEGQVAALAMAVFFKGLSVDERVALTL
GMRDSGDVLDWSDIEAPIVDKHSTGGVGDNVSLMLAPALAANGAAVPMISGRGLGHTGGT
LDKLETIPGYSAKPSNELFRKVVREVGCAIIGQTGDLAPADKRFYGIRDVTATVESIDLI
TASILSKKLAAGLETLVLDVKWGTGAFMANYEDAKALAESLVLVANGAGLKTTALLTDMN
ESLASAAGNAIEVQNAVDFLKGTHVDNRLWDVTVAIGAEGLANSGLADSVDDGKKKMEEA
FTSGKAAELFGKMVGELGGPNDFMEKPEAYLAKAPIQRPVYMPEASLVTGVDARAVGLAV
VELGGGRRAAADEIDPAVGLTDIAGVGTSVDSETPIAIIHAHTEDQVERAEKVLRDAYTF
GSAADVKEFDTIRDRIAP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctcaagaaatcgttcgtaagaaacgtgaaggcgaagtcctgactgcagaagaa
atccagttcttcgtaaagggcatcaccgataacagcgtaactgaaggacaggttgctgct
ctggcaatggctgtgttcttcaaaggtcttagcgttgacgagcgcgtcgctctgaccctc
ggcatgcgtgacagcggtgacgttctcgactggtccgacatcgaagcaccaatcgttgac
aagcactccactggtggtgttggcgacaacgtgtctctgatgctggcacctgcactggct
gcaaacggtgctgcagttccaatgatctccggtcgtggcctcggccacaccggcggtact
ctggacaagctggaaaccattcctggctactccgcaaaaccatctaacgaactgttccgc
aaggttgttcgcgaagttggttgtgcaatcatcggccagactggtgacctagcacctgct
gacaagcgcttctacggtatccgtgatgtgaccgcgactgttgagagcattgatctcatc
accgcatccatcctctccaagaagctggcagctggccttgaaactctggttctcgacgtt
aagtggggcaccggcgcattcatggcgaactacgaagacgcaaaagctttggctgaaagc
cttgttcttgttgcaaacggcgctggtcttaaaaccaccgcattgctgacagatatgaac
gagtctctggcatctgcagctggtaacgcgatcgaagttcagaacgctgtagacttcctg
aaaggcactcacgtcgacaaccgtctgtgggatgtgaccgttgcaattggtgcagaaggt
ctagccaactcaggtcttgctgactccgttgatgacggtaagaagaagatggaagaagcc
ttcacctctggtaaggcagctgaactcttcggcaagatggtcggtgaactcggcggtcct
aacgacttcatggagaagccagaagcataccttgcgaaggctcctatccagcgtccagtt
tacatgccggaagcgtctctggttactggtgttgatgcacgtgcagttggtcttgcagtt
gttgaactcggcggtggtcgtcgtgcagcagcggacgaaatcgatcctgctgttggcctc
acagacatcgctggtgttggcacatctgtagatagcgaaactccaatcgctattatccat
gcacacaccgaagatcaggtagagcgtgcagagaaagttctgcgtgacgcttacaccttc
ggttctgcagcggacgtcaaagagttcgacactatccgtgaccgtattgcgccttaa

DBGET integrated database retrieval system