KEGG   Pseudovibrio sp. FO-BEG1: PSE_1043Help
Entry
PSE_1043          CDS       T01669                                 

Gene name
pdp
Definition
(GenBank) Pyrimidine-nucleoside phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf00240  Pyrimidine metabolism
psf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    PSE_1043 (pdp)
Enzymes [BR:psf01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     PSE_1043 (pdp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C 3Beta_HSD
Motif
Other DBs
NCBI-ProteinID: AEV35555
UniProt: G8PSC9
Position
1094315..1095631
Genome map
AA seq 438 aa AA seqDB search
MLPQEIVRKKREGEVLTAEEIQFFVKGITDNSVTEGQVAALAMAVFFKGLSVDERVALTL
GMRDSGDVLDWSDIEAPIVDKHSTGGVGDNVSLMLAPALAANGAAVPMISGRGLGHTGGT
LDKLETIPGYSAKPSNELFRKVVREVGCAIIGQTGDLAPADKRFYGIRDVTATVESIDLI
TASILSKKLAAGLETLVLDVKWGTGAFMANYEDAKALAESLVLVANGAGLKTTALLTDMN
ESLASAAGNAIEVQNAVDFLKGTHVDNRLWDVTVAIGAEGLANSGLADSVDDGKKKMEEA
FTSGKAAELFGKMVGELGGPNDFMEKPEAYLAKAPIQRPVYMPEASLVTGVDARAVGLAV
VELGGGRRAAADEIDPAVGLTDIAGVGTSVDSETPIAIIHAHTEDQVERAEKVLRDAYTF
GSAADVKEFDTIRDRIAP
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcttcctcaagaaatcgttcgtaagaaacgtgaaggcgaagtcctgactgcagaagaa
atccagttcttcgtaaagggcatcaccgataacagcgtaactgaaggacaggttgctgct
ctggcaatggctgtgttcttcaaaggtcttagcgttgacgagcgcgtcgctctgaccctc
ggcatgcgtgacagcggtgacgttctcgactggtccgacatcgaagcaccaatcgttgac
aagcactccactggtggtgttggcgacaacgtgtctctgatgctggcacctgcactggct
gcaaacggtgctgcagttccaatgatctccggtcgtggcctcggccacaccggcggtact
ctggacaagctggaaaccattcctggctactccgcaaaaccatctaacgaactgttccgc
aaggttgttcgcgaagttggttgtgcaatcatcggccagactggtgacctagcacctgct
gacaagcgcttctacggtatccgtgatgtgaccgcgactgttgagagcattgatctcatc
accgcatccatcctctccaagaagctggcagctggccttgaaactctggttctcgacgtt
aagtggggcaccggcgcattcatggcgaactacgaagacgcaaaagctttggctgaaagc
cttgttcttgttgcaaacggcgctggtcttaaaaccaccgcattgctgacagatatgaac
gagtctctggcatctgcagctggtaacgcgatcgaagttcagaacgctgtagacttcctg
aaaggcactcacgtcgacaaccgtctgtgggatgtgaccgttgcaattggtgcagaaggt
ctagccaactcaggtcttgctgactccgttgatgacggtaagaagaagatggaagaagcc
ttcacctctggtaaggcagctgaactcttcggcaagatggtcggtgaactcggcggtcct
aacgacttcatggagaagccagaagcataccttgcgaaggctcctatccagcgtccagtt
tacatgccggaagcgtctctggttactggtgttgatgcacgtgcagttggtcttgcagtt
gttgaactcggcggtggtcgtcgtgcagcagcggacgaaatcgatcctgctgttggcctc
acagacatcgctggtgttggcacatctgtagatagcgaaactccaatcgctattatccat
gcacacaccgaagatcaggtagagcgtgcagagaaagttctgcgtgacgcttacaccttc
ggttctgcagcggacgtcaaagagttcgacactatccgtgaccgtattgcgccttaa

DBGET integrated database retrieval system