KEGG   Pseudovibrio sp. FO-BEG1: PSE_1051Help
Entry
PSE_1051          CDS       T01669                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_1051
   00052 Galactose metabolism
    PSE_1051
Enzymes [BR:psf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSE_1051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102866..1103858
Genome map
AA seq 330 aa AA seqDB search
MAIRDFGELENRETVKEVTLHGGDLTASILTYGATVRRLQLGDRDLTLGFDNLRDYELHS
PHMGATAGRCANRIANGCFSIGNDEFQLSVNEGGRHHLHGGHTGFAHRIWTIEEASEDSV
LLSLESPDGEEGYPGTVQITCRYTLTKDNTLRIEFSGSTDKPTLLNPAHHSYFNLGDHED
VTKHQIMIPARSYLPVSDELIPTGEILDVAGTAYDFREMRQVQDEQDNRFDNNFCLRQFR
LEKPELSAVVFEPETQIKMEVWSTEPGIQFYDGSSLNTPVPGFNGKMYGPRAGLCLEPQC
WPDSPNHEEFACSTLQPTEHYLQITEYRFI
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtggctattcgtgatttcggtgagctggaaaaccgggaaactgtgaaggaagtgacactg
cacggcggagatctgaccgcaagcatcctcacttacggagccacagtacgcagactgcag
ctgggagaccgcgacctaacgctcggcttcgacaatctgcgcgactacgaacttcactct
ccacacatgggcgccaccgcaggccgctgcgccaaccgcattgcaaacggctgcttctca
atcggcaatgacgagttccaactctccgtcaatgaaggcggacgtcaccatctccacggc
gggcatacagggtttgcgcaccgcatctggaccatcgaagaagccagcgaagacagcgtt
ctgctctctttggaatctccggatggggaagaaggctatccgggcactgtccagatcaca
tgccgctataccctcaccaaagacaacacgctgcgcatcgagttttccggctccacagac
aagccgaccctgttgaaccctgcgcaccacagctatttcaatctgggtgatcatgaagac
gtgacaaaacaccagatcatgatcccggcccgctcttatctgccagtttccgatgagctg
atcccaaccggcgaaatcctcgatgtggctggcaccgcttacgatttccgcgaaatgcgc
caggtgcaggatgagcaggacaaccgttttgacaacaacttctgccttcgccagttccgt
ctggaaaagccagagctgtccgctgtcgtgtttgagcctgaaactcaaattaagatggaa
gtctggtcaaccgagccgggcattcagttttacgatggcagctcgctgaacacacctgtt
ccgggctttaacggcaaaatgtatggcccacgtgctggcttgtgccttgagccccaatgc
tggcctgatagcccaaaccacgaggagtttgcgtgttccacgcttcaaccaactgagcac
tacctgcaaataacagaataccgtttcatctga

DBGET integrated database retrieval system