KEGG   Pseudovibrio sp. FO-BEG1: PSE_1055Help
Entry
PSE_1055          CDS       T01669                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:psf01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:psf00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1105745..1106914
Genome map
AA seq 389 aa AA seqDB search
MTDTLSPAVQICRDLIRCPSVTPAEGGALSTLENLLAGAGFDVSRVTFTDEDTPDVENLF
ATVGTGKPHFVFAGHTDVVPVGDEAAWTHGPFDGTIADGMLHGRGTADMKGGVAAFAAAA
LDYVKAHPDGIPGQISFLITGDEEGPAINGTVKLLEWAKEQGHEFDACIVGEPTNPDALG
DAIKVGRRGSLTGTIKVNGTQGHVAYQHLADNPVPNMLKLLSAVSEVELDKGNERFQPSN
LEITTVDVGNTATNVIPAHVMAKFNIRFNDQWSVKSLSEHVTKLLSDAAPEGLDWSIEYA
KEATDSFLTHDEALIQTLSNSIKTVTGRTPELSTGGGTSDARFIKNYCAVVEFGLVGQTM
HKVDEHVAVADIEQLADIYLRFLQDYFQA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgatacgctttctcctgcggtacagatctgccgcgaccttatccgctgtccaagt
gtcaccccagctgaaggcggtgctctttccacgctcgaaaacctgcttgcaggcgctggt
tttgacgtttcccgtgtcaccttcaccgatgaagatacaccagacgtcgagaacctgttc
gctaccgtcggcacaggcaaaccgcatttcgtttttgcgggacacactgatgttgtgcca
gtgggcgacgaagccgcatggacccatggcccgttcgacggcaccatcgcagatggcatg
ctgcacggacgtggaacggcagatatgaaaggcggtgttgctgcgtttgcagcagccgct
ctggactatgtgaaagcgcatccagacggaattccgggccagatttccttcctcatcacc
ggtgatgaagaaggccctgccatcaacggcactgtaaaactgctggagtgggcaaaagag
caggggcatgagtttgatgcctgtatcgtgggcgaaccaaccaacccggatgctctgggt
gatgccatcaaagtgggccgccgcggctccctgaccggcacaatcaaggtcaacggcaca
cagggccacgttgcctatcagcatctggcagacaaccctgtaccaaacatgctcaaactg
ctgagtgcagtctctgaagtggaactggacaaaggcaacgagcgcttccagccatccaat
ctggaaatcaccaccgtcgacgttggcaacacagccaccaacgttattccagcgcatgta
atggcgaagttcaacattcgctttaacgatcagtggtccgtcaaatctctgagcgagcac
gtcaccaagcttctgagcgacgcagcacctgaggggcttgattggagcattgaatacgcc
aaggaagcaacagacagcttcctgacccatgatgaagcgctgatccagaccctgtccaac
tccatcaagacagtcacaggccgtacaccagagctgtctactggtggcggtacctcagat
gcacgcttcatcaagaattactgtgctgtagttgagttcggcctcgtcggtcagaccatg
cacaaggtcgatgagcacgtcgcagtggcagatatcgagcaactcgccgatatctacctc
cgcttcctgcaagactactttcaggcttga

DBGET integrated database retrieval system