KEGG   Pseudovibrio sp. FO-BEG1: PSE_1301Help
Entry
PSE_1301          CDS       T01669                                 

Definition
glycoside hydrolase, family 42
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSE_1301
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PSE_1301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1365052..1367052
Genome map
AA seq 666 aa AA seqDB search
MSDKKHLGICYYPEHWSEDLWQQDAKEMAALGITYVRIAEFAWSRIEPEPGHFSWDWLDS
AIETLASEGLKIVMCTPTATPPRWMVDKHPDMLAVDENGHPRKFGSRRHYCFSHEGYRWE
SRRITEILAERYGNHQSIVAWQTDNEYGCHETVRSWSASAHKAFQLWLAQKYGNIKALNE
AWGNVFWSMEYNSFEQVDLPNLTVTESNPSHRLDFKRFSSDQVAEFNGEQVDILRKLSPG
RPIIHNFMGNTFSFDHYKIGDQLDISSWDCYPIGFHSQYQMENPLGTPEGYWEDYFQQGD
PDYQAFHHDLYRQAGHGRLWIMELQPGPVNWAPYNPIPLKGMVRLWSWEAFAHGAETTSY
FRWRQAPFAQEQMHAGLKQTDNKPAQAYVEAAQVAREIEELGAFTPSEAPVALVVDYESH
WAHETQQQGQDFSYFRLVLAYYRALRQKGVDVEIIRPASQDLSPYKLVIVPALYAMSEEL
SENLAAYVEFGGVVLGGPRLAQKDKNYQISQKTLNLPKPFEAIEVLRVGTSPKEFATTVS
DLADQERGKAYVWQEEVTTGLPILFEDTNDHPVFTGENNIYYVSAWADPALMSAILDEVF
KAAKIDKVELPNGLRRSKTSIGTFYYNYSKNKMNLKALRLADAAELDGLELPPAGVALVR
EGTEEL
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataagaaacacttaggtatctgttactacccagaacactggtcagaggactta
tggcagcaagatgccaaagaaatggccgcgctgggcattacctatgtgcgtatcgctgag
tttgcatggtcccgcattgagccagaacccggacacttctcatgggactggttggacagc
gccattgagactctcgcaagtgagggtctcaagatcgtcatgtgtaccccaaccgctact
ccaccacgctggatggtggataagcacccggacatgctcgccgtagacgaaaacggccac
ccccgaaagttcggcagccgccgccactactgcttctcccacgaaggctaccgctgggaa
tctcgccggatcacggaaatcctcgccgagcgatacggtaatcaccagtccatcgtcgcc
tggcaaaccgacaacgagtacggttgccatgagacagtccgctcatggtctgcgtctgca
cacaaagccttccagctctggctggcgcaaaagtacggcaatatcaaagccttgaacgaa
gcttggggcaatgtgttctggtccatggaatacaacagcttcgagcaggtcgatctgccg
aacctgaccgtgacagagagtaacccatctcacaggcttgatttcaaacgcttttcatcg
gatcaagtcgccgagttcaacggagagcaggttgatatcctgcgcaagctctccccgggc
cgcccaatcatccataacttcatgggtaacacgttctccttcgaccactacaagatcgga
gaccagctcgatatctccagttgggattgctatcccattggtttccatagtcaatatcag
atggaaaaccctctgggcacaccagaaggctactgggaagattacttccagcaaggtgat
ccagattatcaggccttccatcacgacctctacagacaagcaggccacggccgcctctgg
atcatggagttgcaacccggccccgtgaattgggcaccttataatccgatcccgctgaag
ggcatggtgcgcctgtggagctgggaagctttcgcccatggtgctgaaaccacaagctat
ttccgctggcgtcaagcgccattcgcgcaagagcaaatgcatgcagggctcaagcagacc
gataacaaaccagcacaggcctatgtagaagccgcgcaggttgcccgtgaaatcgaggag
ctcggtgcattcacaccctctgaagctcccgttgctcttgtcgtagactacgaaagccac
tgggcacatgaaactcagcagcaaggtcaagactttagctacttccggctcgttctcgcc
tactatcgcgcgctcaggcagaagggcgttgatgtagagatcatcaggccagcctcacaa
gacttatccccctacaagctggtgattgtccccgccctgtacgcaatgagcgaagaacta
tccgaaaacctcgccgcctatgtcgaattcggcggcgtcgtcctcggcggtcctcgcctc
gcgcaaaaagacaaaaactatcagatctcacaaaagactttgaacctgccaaaacccttt
gaggccattgaggttttgcgcgttggtacaagcccgaaagagttcgcaaccaccgtctca
gacctcgctgatcaggaacgcggcaaagcctacgtctggcaagaagaggtcaccactggc
ctaccgatcctgttcgaagataccaacgaccatccggtctttacgggcgaaaacaacatc
tactacgtttccgcatgggcagacccagctctgatgagcgccattctggatgaggtcttc
aaggctgcaaaaatagataaggtggaattgccaaacggattgagaagaagcaaaacgtcc
attggcactttctattataactattcgaaaaataagatgaatttgaaagcgctgcgtctt
gctgatgcagcggaattggatggattggagctgcctcccgctggggtggctctggttcgg
gaaggaactgaagagctatga

DBGET integrated database retrieval system