KEGG   Pseudovibrio sp. FO-BEG1: PSE_1331Help
Entry
PSE_1331          CDS       T01669                                 

Gene name
adhE
Definition
Aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    PSE_1331 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_1331 (adhE)
   00620 Pyruvate metabolism
    PSE_1331 (adhE)
   00650 Butanoate metabolism
    PSE_1331 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    PSE_1331 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    PSE_1331 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    PSE_1331 (adhE)
   00626 Naphthalene degradation
    PSE_1331 (adhE)
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     PSE_1331 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     PSE_1331 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1402513..1405182
Genome map
AA seq 889 aa AA seqDB search
MPVTNREELDALVARVKKAQQIYATYTQEQVDKIFRAAALAAADARIPLSRMAVEETGMG
VMEDKVIKNQFASEYIYNKYKDEQTCGILSEDETFGTITIAEPTGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKLATNEAARIVLEAAIKAGAPKDIIGWIDVPTVELSNA
LMTHEEINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDEFADVKRMVASVLMSKTF
DNGVICASEQSVIVVEDIYEQVKERFSTHKGYILKGKELQAVKDVLLKNGALNAAIVGQP
APKIAEMAGVKVPADTKILIGEVTEASEAEAFAHEKLSPTLAMYKAKDFDAACDIAEKLV
AMGGIGHTSVFYTDQDRCEDRVKEFGRRMKTARILVNSPASHGGIGDLYNFSLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPESIYFRRGCLPIALGDLEGKKRA
LIVTDGFLFKNGYTDETVRVLKSMGMETDVFYEVEADPTLSIVRKGAELCRTFKPDVIVA
LGGGSPMDAAKIMWVMYEHPEVDFADLALRFMDIRKRIYKFPKMGEKAMMVAIPTTSGTG
SEVTPFAVVTDDETGVKYPIADYELTPNMAIVDANLVMNMPKSLTAFGGIDAITHATEAY
VSVLANEYSDGQALQALKLLKENLVESYEKGAESPVAREKVHNGATIAGVAFANSFLGVC
HSIAHKVGAAFHVPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQAKCRYGDIADHL
GLTTPGDDRDAKVEKLVAWVESVKKALEIPAGFKDLGITEEQFMAKLDEVAVEAFDDQCT
GANPRYPLIDEIKQLLLDGYYGRVYVEGRAEDVVVLAEEKAKKASKAKA
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtcactaatcgcgaagaattagacgcccttgttgctcgggttaaaaaagcacaa
caaatctacgcaacatacactcaagaacaggtagataagatcttccgcgcagcagcactg
gccgctgccgatgcccgcatcccgctctcccgcatggcggttgaagaaaccggtatgggc
gtcatggaagacaaggttatcaaaaaccagttcgcatctgagtacatctacaacaagtac
aaggatgagcagacctgcggtatcctgtctgaagatgaaactttcggaacaatcaccatt
gcagaaccgacaggcatcatctgcggtatcgttccaaccacaaacccaacttctactgcg
atctttaaagcgctcatctctttgaagacccgcaacggcattatctttagcccgcaccca
cgcgctaagctcgcaaccaacgaggccgcacgcatcgtccttgaggctgcaatcaaagca
ggcgctccaaaagacatcattggctggattgacgttccaactgttgaactctccaatgcc
ctgatgacccatgaagaaatcaacctcatcctcgcgaccggtggtccgggcatggtgaag
gctgcttattcttctggtaagccggcaatcggcgtgggtgcgggtaacacacctgtggtg
gtagatgagtttgcagacgtaaaacgcatggtcgcatctgtcttgatgtctaaaacattc
gacaacggtgtgatctgtgcatctgaacagtctgtcatcgttgtagaagacatctacgaa
caggtgaaagaacgcttctcaacccacaaaggttacatcctgaaaggcaaagagcttcag
gctgtgaaggatgttctgctgaagaacggtgcgctcaacgcagcaatcgttggtcagcct
gctccaaaaatcgctgaaatggctggcgtgaaagttcctgctgacaccaagatcctgatc
ggtgaagtgacagaagcaagcgaagcagaagcattcgctcacgagaagctgtctccaact
ctggcaatgtacaaagccaaagattttgatgcggcttgtgacattgctgaaaagctggtt
gccatgggcggtatcggtcacacctctgtattctatacagatcaggaccgctgcgaagat
cgcgtcaaagagtttggccgtcgcatgaaaaccgcgcgtattctggtcaattccccagca
tctcacggcggtatcggtgacctttacaacttctctctcgctccatctctgacccttggc
tgtggctcttggggtggtaactccatcagtgagaacgttggtccaaaacacctgatcaat
aagaagaccgttgcgaagcgagcagaaaacatgttgtggcacaaactgcctgaatccatc
tacttccgtcgcggttgtctgccaatcgcactgggtgaccttgaaggcaaaaaacgtgcg
ctgatcgtaaccgacggcttcctcttcaagaacggctacactgatgaaaccgttcgcgtc
ctgaagagcatgggtatggaaaccgacgtcttctacgaagtggaagcagacccaaccctg
tctatcgttcgcaaaggtgcagaactgtgccggaccttcaagccagacgtgattgtcgct
ctgggtggtggttctccaatggatgctgcgaagatcatgtgggtcatgtacgagcaccca
gaagtagatttcgctgatcttgcactgcgcttcatggacatccgtaagcgtatctacaag
ttcccgaaaatgggtgagaaggccatgatggtcgcgatcccaaccacttctggtactggt
tctgaagttaccccattcgcagtggtaaccgacgatgaaaccggcgtgaaatacccaatc
gcggactatgagctgacaccaaacatggcaatcgttgatgccaaccttgtcatgaatatg
ccgaagtctctcaccgcattcggtggtatcgacgccattacccacgcaacagaagcttac
gtctctgttctggccaacgaatattctgacggtcaggccctgcaggctctgaagcttctg
aaagagaacctggttgaaagctacgagaagggcgcagaatccccagtagctcgtgagaaa
gttcacaacggcgcaacaatcgctggtgttgccttcgcgaactccttcctgggtgtctgt
cactctatcgctcacaaggtaggcgctgccttccacgtgccgcatggtttggcaaatgcg
atgctgatctctaacgtgatccgctacaacgcaaacgacaacccaaccaagcagaccgcg
ttctctcagtacgaccgtccgcaagcgaaatgccgctacggtgacatcgcagaccacctc
ggcctgaccacacctggcgacgatcgcgatgcaaaggttgaaaagctggtggcttgggta
gaaagcgtcaagaaagctcttgagatcccagcaggcttcaaagacctgggcatcactgaa
gagcagttcatggcaaagctcgacgaagtcgcagtagaagcgtttgatgatcagtgcaca
ggagcaaacccacgctacccactgatcgatgagatcaaacaactccttctcgatggttac
tacggtcgcgtctatgtagagggccgcgcggaggatgtggttgttcttgcagaggaaaaa
gcaaagaaggcctctaaagccaaagcttaa

DBGET integrated database retrieval system