KEGG   Pseudovibrio sp. FO-BEG1: PSE_1360Help
Entry
PSE_1360          CDS       T01669                                 

Gene name
soxE
Definition
Diheme cytochrome c SoxE
Orthology
K08738  
cytochrome c
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSE_1360 (soxE)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSE_1360 (soxE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1441271..1442008)
Genome map
AA seq 245 aa AA seqDB search
MLRALHKKTPASFRRFAASSLVALGFLSGAVSIASAQDIARGERLFNACLRCHDVGKDAK
NRIGPHLNGVFDRKAASIEGAKYSKAMKRAGADGLRWNIDTLNIYIQNPKNLVSGTRMNY
RGMRKEKDRSDLLAYLRQFSVSPANIPEASASLLKQDAPSIHEEAYLDGDAEYGEYLSSE
CTSCHQSSGADKGIPAITGWPQPDFVIALRAYKKGHRPHPVMQMIAKRLSEEEIAALAAY
FKGLD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcgtgccctgcataagaaaactcctgccagttttcgcaggttcgcagcctctagc
cttgttgcgcttggtttcctgtcaggggcggtctccattgcctctgcgcaggatattgcg
cgtggtgagcgcctgttcaacgcttgcctgcgctgtcatgatgttggcaaggatgccaag
aaccgcatcgggccccacctgaatggcgtgtttgaccgcaaggcagccagcattgaaggc
gccaagtactccaaagctatgaaacgtgccggagcagatggcctgcgctggaacatcgac
acgctgaacatttacatccaaaatccgaagaacctggtttcgggcacgcgcatgaactac
cggggcatgagaaaagagaaagatcgctctgatcttcttgcttacttgcgccagttctcc
gtcagcccggccaacattccggaggcgtctgccagccttttgaaacaggacgccccgagc
attcatgaggaagcctatctggacggcgatgctgaatatggcgagtatctttcttctgaa
tgtaccagttgccatcaatccagcggagcagacaaagggatccctgctatcacaggctgg
ccgcaaccggattttgtgattgctttgcgcgcttataagaaaggacaccgaccccatccc
gttatgcagatgatcgccaagcggctctcggaggaggagatcgcagctctggcggcttat
ttcaaaggcctggattaa

DBGET integrated database retrieval system