KEGG   Pseudovibrio sp. FO-BEG1: PSE_1387Help
Entry
PSE_1387          CDS       T01669                                 

Gene name
hex20
Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_1387 (hex20)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PSE_1387 (hex20)
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSE_1387 (hex20)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467138..1469057
Genome map
AA seq 639 aa AA seqDB search
MEAAACADTAIRMETWRTEDRQVSCILSAKCDAPISNYTLCFSMLAPCEVVEGANTHRMT
AGYVELQFDNDKLGTGQALAFTLKYKSNMNPSNRSWLPKGAYLRMEDGSILPVQITPRGI
DQTYSTKLPEQHADPSSDELMLVPAPQSWQPTGATLNVSAGYKLDRSWDTDGEADSTEAV
EMLAERNNIGPFLAEEGTPLHFTRNAGLAEDAYELTIAPDGITLTASAAAGAFYGAITLL
NLKQIYGGTIPCGQIADAPRFEWRGQHLDCARHYYEPETLLRLVDMMALFKLNRFHWHFC
DDEAFRLEVESYPELWKKSGMRGEGRVVPGIYGAADGPQGGTYSKAFASRLVEHAKALHI
EVLPEIEIPAHSWAVLQIHPELREAADESNEVSVHGYLNNTINPALPEAWTYMEALAKEV
SGIFPFAHLHLGCDERPPAAWTKSPAIEQLKAEQGLETADDVQGWMMDKLGAYVSSLGVR
PAAWEEAAKGANGGINNDAILFSWTQQGPGLEAARKGYSVVMTPAAHAYWDIAPSGEFNE
IGLNWAGITSLADSVNWDPVPENEPELEGKIIGAQGCLWSEVVLRDANMESMMAPRILGI
SEIGWATRANKPDAEQITQKAACYNKLFAAIGWRQDVRD
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgctgcctgtgctgatactgcaatcagaatggaaacatggagaacggaggac
cggcaggtcagctgcatcctctctgccaaatgcgatgcaccaatctccaactacacactc
tgcttcagcatgcttgctccgtgcgaagtggtcgaaggtgccaacacccaccgtatgaca
gcggggtatgtggagctgcagttcgacaatgacaagctgggaacagggcaggcgctggcg
tttacgctcaagtacaaaagcaacatgaacccctccaaccgcagctggctgcccaagggc
gcttacttgcggatggaagatggcagcatcctgccggttcagatcaccccgcgtgggata
gaccaaacctactccaccaaactgcctgagcaacacgccgacccttcctctgatgagctg
atgctcgtgccagccccgcaaagctggcaacccactggcgcaacgctgaatgtcagcgct
ggctataagctcgaccgttcatgggatacggatggcgaggccgacagcactgaagccgtg
gaaatgctggcggaacgcaacaacatcggcccgttccttgcagaagaggggacgccgctc
cacttcaccagaaacgctggactggcagaagatgcctatgagctgacaattgcgccagat
ggcatcacgctcaccgcatccgcagcagcaggcgctttttatggcgcgatcacccttctt
aatctcaagcagatctatggcggcaccattccatgcggtcagatagcagacgcgcctcgc
tttgaatggcgcggtcagcatctggattgcgcccgccactattacgagccggaaacactg
ctgcggctcgtcgatatgatggccttgttcaagctcaaccgcttccactggcacttctgc
gatgatgaggccttccgtctggaggtggaaagctatccggaactctggaagaaatctggc
atgcgtggagaaggccgtgttgtacccggcatctacggcgcagcagatggcccacaaggc
ggcacctactccaaggcctttgccagccgactggtggagcacgccaaagcgctccatatc
gaagttctgccggagatcgagatacccgcccactcttgggccgtgctccagatccatccg
gaactgcgcgaagctgccgatgaaagcaacgaggtctccgttcacggttacctgaacaac
accatcaacccggccttaccggaagcatggacttacatggaagcgctggccaaagaagtc
tccggcatcttcccattcgcgcatctccatctgggatgtgatgaacgtccgccagcggca
tggaccaaatcaccggccattgaacagctaaaggcagaacaggggttagagaccgctgat
gatgtgcagggctggatgatggacaaactgggggcctacgtcagctcgctgggcgtacgt
cccgccgcttgggaggaagcagccaaaggtgcaaacggcggcatcaacaacgatgccatc
ctgttctcatggacccagcagggaccggggctcgaagctgcccgcaaaggctactccgtc
gtgatgacaccagcagcgcatgcctattgggacattgcaccgtcaggcgagttcaacgag
attggcctcaactgggcaggcatcacaagccttgctgatagcgtcaactgggatccggta
ccggaaaatgagccagagttggaaggtaagatcatcggtgcgcaaggttgcttgtggtca
gaggttgttctgcgggatgccaatatggaaagcatgatggcgccgcgcattctgggcatt
tcagaaatcggctgggccacccgcgctaataagccggatgcagagcaaatcacgcaaaaa
gccgcctgctacaacaagctgttcgctgctattggttggcgtcaggatgtcagagactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system