KEGG   Pseudovibrio sp. FO-BEG1: PSE_1460Help
Entry
PSE_1460          CDS       T01669                                 

Definition
(GenBank) diheme cytochrome c SoxD
  KO
K08738  cytochrome c
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
psf02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psf00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSE_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: AEV35972
UniProt: G8PQT3
Position
complement(1543631..1544029)
Genome map
AA seq 132 aa AA seqDB search
MKQFGVVAALALLVSTGAAFAEGDVAKGSKVFKKCKACHAVGEKAKNKVGPQLNGIVGAG
WGEVEGYKYSKPLLAGKEEGKSWDEATLDAYLTKPKKVIPKGKMAFAGLKKEQQRQDVIA
YLAQFNKDGSKK
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagtttggcgtcgttgcagcgcttgcattgctggtgagcacaggtgcggcattc
gcggaaggcgatgttgctaagggctctaaagttttcaaaaaatgtaaggcttgtcatgct
gttggtgaaaaagccaagaacaaggtaggtccacagctcaacggtatcgttggtgcaggc
tggggtgaagtcgaaggctacaagtactccaaacctcttctggcaggtaaagaagaaggt
aagtcttgggacgaagctactcttgacgcttacctcaccaagcctaagaaagttatccct
aaaggtaagatggctttcgctggtcttaaaaaagaacagcagcgtcaggacgttatcgcg
tacctcgctcagttcaacaaagacggttccaagaaataa

DBGET integrated database retrieval system