KEGG   Pseudovibrio sp. FO-BEG1: PSE_1729Help
Entry
PSE_1729          CDS       T01669                                 

Gene name
fadJ
Definition
Fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSE_1729 (fadJ)
   01212 Fatty acid metabolism
    PSE_1729 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSE_1729 (fadJ)
   00650 Butanoate metabolism
    PSE_1729 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    PSE_1729 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    PSE_1729 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSE_1729 (fadJ)
   00310 Lysine degradation
    PSE_1729 (fadJ)
   00380 Tryptophan metabolism
    PSE_1729 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSE_1729 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSE_1729 (fadJ)
   00281 Geraniol degradation
    PSE_1729 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    PSE_1729 (fadJ)
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSE_1729 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSE_1729 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSE_1729 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1824980..1827193)
Genome map
AA seq 737 aa AA seqDB search
MTYTHFTLETDADGFAVLKWDSPEKPMNVFDESVINELDKVIDDITADDAIKGVVVASGK
KAFSAGADLSMIGKALGDYKKRQSVDPEGAAKELFEGTRKLSLVFRKMETSGKPYVAAIN
GVSMGGGTELALACHKRIGAEESLKMALPEVKVGLFPGAGGTQRVMRMVPDLQGGLQFLL
MGQNLDAKKALRLKLIDDVAPEAELVDAAKKMLAEGVDPVAPWDKKGFKIPTGKVYSPSG
MQFWPAANAIYRQNTYDNYPGARYMLHSVVEGLMVPFDTGLTIESRYFAHVLQSKEAAAM
VRSLFGSMQELNKGARRPAGVPESNLKKVGVLGAGMMGAGIAYVTAKAGLEVVLIDQSQE
AADKGKSYSSDLMDKAIKRKKSTPEKKEKLLSLITATTDYSALSDVDLVIEAVFEDREVK
RVVTEQAEAAMPASAIYASNTSTLPITSLAEASSRPADFIGIHFFSPVDKMMLVEIILGE
KTEDKATAVALDYVKAIKKTPIVVNDSRGFYTSRVVGTYVREGIMMLSDGVPAAMIENAG
KMAGMPVGPLSLGDEVALDLAWKIKEATKKDLGDAYPSSGFDEILDAMVVKHERHGRKNT
KGFYDYKGKDKALWPGITEITGPAKSADEFNVEELKDRLLGIQALETARVFEENCLTDVR
EADVGSILGFGFAPFSGGTLSYIDGIGTKEFVERCDKLAAKWGDRFAPNKQLRAMAEAGE
TYYGKFSPAEAVAEAAE
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgacatacacacactttacccttgaaaccgatgcagacggctttgcagttctgaaatgg
gactcgcctgaaaagccgatgaacgtgtttgacgagtccgtcatcaacgagctggacaaa
gtcatcgacgacatcactgctgatgacgccatcaagggtgttgttgttgcttccggcaag
aaagcattctccgcaggtgctgacctttccatgatcggcaaggctcttggtgattacaag
aagcgccagagcgttgatcctgaaggtgcagcgaaagaactgtttgaaggcactcgtaag
ctttcactcgtgttccgcaaaatggaaacctccggcaagccatatgtggctgcaatcaac
ggtgtttccatgggtggcggcaccgagctggctctggcttgtcataagcgtatcggcgct
gaagaaagcctgaagatggctctgcctgaagttaaggtggggctgttcccaggtgccggt
ggtacgcagcgcgtgatgcgcatggtgcctgatcttcaaggtggcctgcagttcctgcta
atgggtcagaaccttgatgccaagaaggctctacgcctgaagctgattgacgacgttgcg
cctgaagctgagcttgttgatgctgccaagaagatgcttgctgaaggcgttgaccctgtt
gcgccttgggacaagaagggcttcaagatccctaccggtaaggtttactccccatccggt
atgcagttctggccagcagcgaacgcgatctaccgtcagaacacctatgacaactatccg
ggcgcacgctacatgctgcactctgttgtcgaaggtctgatggttccattcgacactggt
ctgaccatcgagagccgctactttgcgcatgttctgcagagcaaggaagctgctgctatg
gttcgctccctgtttggttccatgcaggagctgaacaaaggcgcacgccgtccagcaggc
gttccggaaagcaaccttaaaaaggttggtgttcttggtgcaggcatgatgggcgcaggc
attgcctatgtgacagcaaaagctggccttgaagttgttctgatcgaccagtctcaggaa
gctgcagacaagggtaagtcctactcttcagacctgatggacaaggctatcaagcgtaag
aaatctacgcctgagaagaaagagaagctgctcagcctgatcaccgcgaccaccgattac
agcgcgctgtctgacgtggatctggttattgaagctgtgtttgaagaccgtgaagtgaag
cgcgttgtgaccgagcaagcagaagcagcgatgccagcttccgcgatctacgcgtccaac
acctctacgcttccgatcacttctctggcagaagcttcttctcgtcctgcagacttcatc
ggcattcacttcttctccccagtggacaagatgatgcttgttgagatcattctgggtgag
aagaccgaggacaaggcaactgctgttgctctggactacgtgaaagcaatcaagaagacc
ccgattgttgtgaatgacagccgtggcttctacacctctcgcgttgttggcacctacgtt
cgcgaaggcatcatgatgctttccgatggtgttccggcagcgatgattgagaacgctggc
aagatggcaggcatgcctgttggtccgctgtctctgggtgatgaagttgctctggacctt
gcctggaagattaaggaagctaccaagaaagaccttggtgatgcgtatccatccagcggg
ttcgatgagatccttgatgcgatggttgtgaagcatgagcgtcatggccgtaagaacacc
aagggcttctacgactacaaaggcaaagacaaggctctgtggcctggtattaccgagatc
accggcccagcgaagtccgctgatgagtttaacgttgaagaattgaaggaccgtctgctt
ggcattcaggctcttgaaaccgcacgcgtgtttgaagagaactgcctgacagacgttcgt
gaagcagacgttggctccatccttggcttcggctttgcgccgttctccggtggtacgctg
tcctacatcgacggcatcggcaccaaagagttcgtagagcgctgtgacaagctggctgcc
aagtggggcgaccgcttcgcaccaaacaaacagctgcgcgcaatggcagaagctggtgag
acttactacggtaagttctcccctgcagaggctgtggcagaagctgctgagtaa

DBGET integrated database retrieval system