KEGG   Pseudovibrio sp. FO-BEG1: PSE_1775Help
Entry
PSE_1775          CDS       T01669                                 

Definition
Histidinol dehydrogenase, prokaryotic-type
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSE_1775
  Amino acid metabolism
   00340 Histidine metabolism
    PSE_1775
Enzymes [BR:psf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PSE_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1877782..1879077
Genome map
AA seq 431 aa AA seqDB search
MAIKLSSKSEGFEEEIRALLGSKRETSEDVDHIVRDILHDVETRGDAAVLEYTNKFDRMS
AKSMDELKVTEAEIEAAVAQIPAETLEALQLAHDRIRSHHQKQLPESYTYKDAIGVELGA
IWTAVEAVGVYVPGGLASYPSSVLMNVVPAKVAGVERIVMVVPSPDNVLNPLVLAAAKMS
GVSEIYRIGGAQAVGALAYGTETIAPVSKIVGPGNAFVSAAKRRVFGTVGIDMIAGPSEI
LVVADKDNNPDWVAVDLLSQAEHDPVAQSILITDSEELAQAVEEAVERQLTTLPRADVAR
QSWNDFGAIITVDNLDDAMVLSNRFAPEHLELCVDDPDALLPKMRNAGAVFVGRYTPEAI
GDYVGGSNHVLPTARSARFSSGLSTLEFVKRTSLLRCNPENLAQIGPAAVTLAEVEGLQA
HGRSVSIRLNH
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtggcgataaagctctcctcaaagtctgaaggtttcgaagaagaaattcgtgccctgctt
ggaagcaagcgggaaacttcagaggatgtggatcatatcgtgcgcgacatcctacatgat
gtcgaaacgcgcggtgatgcggccgtgctcgagtacaccaacaagtttgaccgtatgtcg
gccaaatcaatggacgagctaaaagtaactgaagcggagatcgaagcagctgttgctcag
atccctgctgaaacactggaagcattgcagcttgcccatgatcgtattcgttcccaccat
caaaagcagctgccggaaagctacacctataaagacgcaatcggcgtagagctaggtgcc
atctggactgcagtggaagctgttggcgtgtacgtaccaggcggccttgcaagctatcca
tcctccgttctcatgaacgttgttcctgcaaaggtggcgggcgttgagcgcatcgtgatg
gtggttccaagcccagacaatgtgctgaacccacttgtgctggccgctgccaaaatgtct
ggcgtctctgagatttaccgcatcggtggtgctcaggctgttggtgcgctggcatatggc
acggaaacaatcgcgccggtctccaagatcgttggcccaggcaacgcattcgtttccgca
gcaaagcgccgtgtgtttggcactgttggcatcgatatgatcgctggcccttccgagatc
ctcgtcgtagcagacaaagacaataacccggattgggtcgctgtcgatctattgtctcag
gctgaacatgatccggtcgcgcagtccattctcatcacagacagtgaagaactggcacaa
gccgttgaagaagctgttgagcgtcagctgaccacactgccacgggcagatgtagcccgt
caaagctggaatgacttcggcgccatcatcaccgtcgataatctggacgatgccatggtg
ctgtccaaccgcttcgctccagagcaccttgagctctgcgttgatgatccagatgcgctt
ctgccgaagatgagaaacgctggcgctgtgtttgttggtcgctacacaccagaagcaatc
ggcgattatgtcggcggctccaaccacgtgttgccaacggcacgctctgctcgcttctcc
tctggtctttccacgctggagtttgtgaaacgaacatcgctcctgcgctgtaatccggaa
aatctggcgcagattggcccggcagccgtcacccttgcagaggtggagggcttgcaggca
catggacgttcagtctcaattcgcttaaatcactag

DBGET integrated database retrieval system