KEGG   Pseudovibrio sp. FO-BEG1: PSE_2403Help
Entry
PSE_2403          CDS       T01669                                 

Gene name
glcB
Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSE_2403 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSE_2403 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    PSE_2403 (glcB)
Enzymes [BR:psf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSE_2403 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2543370..2545553
Genome map
AA seq 727 aa AA seqDB search
MSQRVSVASLQVSPELYNFVEKEALPGTGVTSDQFWEGFAQIIKDLTPRNRELLQIREDI
QTKIDDWHKANPDTIDLETYKTFLKELGYLLPEGESFDVDTANVDPEIAEIAGPQLVVPV
MNARYALNAANARWGSLYDALYGTDAMGSTPQAGGYDEARGAEVIAYARKKLDEALPLDE
GSWADVTEFAIMGGSLALTLENGDMAGLQDPLGFVGYAGNKDEPKSILLQKNGLHFDVLF
DRSSPIGAADKAGISDIILESAISTIMDCEDSVAAVDGEDKALAYCNWLGLMNGDLKEEV
SKGGKTFTRALNGDRHYTDAQGDALALKGRSLMLVRNVGHLMTNPAILDEDGNEVFEGIM
DAMVTSLCAIHDIGLREGATARNMNSVTGSVYIVKPKMHGPEEVAFADELFGRVEHVLEL
PRNTLKMGIMDEERRTTVNLKECIRAAKSRVCFINTGFLDRTGDEIHTSMEAGPMIRKAD
MKQATWISAYENHNVDTGLACGLREHAQIGKGMWAMPDLMHTMLEQKISHPKAGANTAWV
PSPTAATLHAMHYHQVCVPAVQEELSTREPAKLDDILSIPVATNPNWTPEDIQAEVENNA
QGILGYVVRWVEHGVGCSKVPDIHNVALMEDRATCRISSQHIANWLHHNVCSEEQVLEIM
KRMAAVVDEQNAGDPAYHNMAPDFDNSVAFQAACDLVFKGRIQPSGYTEPVLHKRRLEAK
AKFAASA
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaaagagtaagtgttgcatcacttcaggtttcaccggaactctacaatttcgta
gagaaggaggctcttccgggcaccggagtgacatccgaccagttttgggaaggcttcgcg
cagatcatcaaggatctgacaccacgcaaccgcgaactgctccagatccgtgaagacatc
cagaccaagatcgacgactggcacaaagccaacccggacacgattgatctggaaacctac
aaaaccttcctcaaagaacttggctacctgctgcctgaaggtgaaagcttcgacgttgat
acagccaacgtcgacccggaaatcgcagagatcgccggtcctcagctcgttgtgcctgtc
atgaatgcgcgctacgccctcaacgctgccaatgcgcgttggggttccctgtatgatgcg
ctttacggcaccgacgccatgggctccacccctcaggcaggcggatacgacgaagcgcgc
ggcgcagaagtcatcgcctatgcccgcaagaagctggatgaggctctgcctctggatgag
ggcagctgggctgacgtcaccgagtttgccattatgggtggctcactggctctgacgctg
gaaaacggcgacatggcaggcctgcaggacccactcgggtttgttggctatgctggtaac
aaggacgagccaaagtccatcctgctgcagaaaaacggcctgcattttgatgtactgttt
gaccgctccagcccgatcggtgcagctgataaagcaggcatcagcgatatcattctggaa
tctgccatctccaccatcatggactgcgaagactctgttgcagctgtagacggtgaagac
aaagcactggcctactgtaactggctgggcctgatgaatggcgacctgaaagaagaagtt
agcaaaggcggcaaaaccttcacccgtgccttgaatggtgaccgtcactacaccgatgcg
cagggcgatgctctggcgctgaagggccgctccctcatgctggtgcggaacgtcggtcat
ctcatgaccaacccggcgatccttgatgaggatggcaatgaggtctttgaaggcatcatg
gacgctatggtgacctccctctgcgcgatccacgatatcggcctgcgtgaaggtgcaact
gcccgcaacatgaactccgtaaccggctccgtttacatcgtgaagccaaagatgcacggc
ccggaagaagttgctttcgcggacgagctgtttggccgcgtggaacatgttttggagctg
ccacgcaacaccttgaaaatgggtatcatggatgaggaacgccgcaccacggtcaacctc
aaagagtgcatccgtgccgccaagtctcgtgtatgcttcatcaacaccggcttccttgac
cgcactggtgacgagatccacacctccatggaagctggcccaatgatccgcaaggcggac
atgaagcaggccacatggatcagcgcttatgagaaccacaatgtagacaccggccttgcc
tgtggtctgcgtgagcatgcgcaaatcggcaaaggcatgtgggccatgccagacctgatg
cacaccatgctggagcagaagatcagccatccaaaagcgggcgctaacaccgcatgggtg
ccatcgccaaccgcagcaaccctgcatgccatgcactaccatcaggtctgtgtaccagcc
gttcaggaagaactgtcgacccgtgaacctgcaaagctggatgatatcctgtccattccg
gttgccaccaatccaaactggacaccggaagacattcaggcagaagttgagaacaacgcg
caaggcatccttggatacgttgtgcgctgggtagagcacggtgtcggctgctccaaagtg
ccggacatccataatgtggctttgatggaagaccgcgcaacctgccgcatctcctcgcag
cacatcgccaactggctgcaccacaatgtctgctctgaagagcaggtgctggagatcatg
aagcgcatggctgctgtggtggatgagcagaatgcaggcgacccggcctatcacaacatg
gcgcctgactttgacaactccgtcgccttccaggctgcatgtgatctggtcttcaaaggc
cgcatccagccaagcggttacacagaaccagtgctgcataaacgccgccttgaagccaag
gcgaagttcgccgcatcagcctga

DBGET integrated database retrieval system