KEGG   Pseudovibrio sp. FO-BEG1: PSE_2526Help
Entry
PSE_2526          CDS       T01669                                 

Gene name
algC
Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSE_2526 (algC)
   00030 Pentose phosphate pathway
    PSE_2526 (algC)
   00051 Fructose and mannose metabolism
    PSE_2526 (algC)
   00052 Galactose metabolism
    PSE_2526 (algC)
   00500 Starch and sucrose metabolism
    PSE_2526 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    PSE_2526 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    PSE_2526 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSE_2526 (algC)
Enzymes [BR:psf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     PSE_2526 (algC)
    5.4.2.8  phosphomannomutase
     PSE_2526 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2682645..2684156
Genome map
AA seq 503 aa AA seqDB search
MSVKPVSKLTPNTLAYETTPLVKPTGFREYDARWLFEEEINLKGIQALGEGLGTLIHELG
VRPEIVTGHDFRGYSASIKMALITGLMSAGIKVHDIGLAMSPMAYYAQFDLDVPCVAMVT
ASHNDNGWTGVKMGANRPLTFGPEEMGRLKEIVLEGKSDLRGGGSYEYHPDLADRYIADL
TEREKLKRPIKAVVACGNGTAGAFAPRILEALGVDVIPLDCELDHTFPNYNPNPEDMKML
HAIRDKVLETGAEVGLGFDGDGDRCGVVDNEGEEIFADKVGVMLARDISALHPETQFVVD
VKSTGLYHTDPVLKANGAKTDYFKTGHSYIKRRVTELGAIAGFEKSGHYFFNPPIGRGYD
DGVVSAVAVLDMMDRNPDKTMADLRRDLPKTWGSPTMAAKCADEIKYDVVDRVVERFKSM
KAEGAKVSGHDIDDLITVNGVRVVCDDGTWGLVRASSNKPELVVVVESPVSEERLHEMFK
AMDSVLRENPEVGDYNQTLAELA
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaccggtttcaaagctaacgccgaacaccttggcctatgaaacgacaccg
ttggtcaagccaaccggttttcgcgagtacgatgcgcgctggctctttgaagaagagatc
aacctgaagggcattcaggcgctgggcgaggggctcggaactctcattcatgaacttggt
gttcgccctgagatcgtaaccggtcatgactttcgcggttactctgcctcaatcaaaatg
gccttgatcactggtctcatgtcagctggcatcaaggtgcatgacattggcctcgccatg
tctccaatggcttactacgctcagtttgatctggatgtcccatgcgtggcgatggtcaca
gcctcccacaacgacaacggctggaccggcgtaaaaatgggcgcaaaccgtccgctgacc
tttggtccggaagaaatgggtcgcctgaaggagatcgttctggaaggcaaaagtgatctg
cgtggtggtggttcctatgagtatcacccggatctggcagaccgctacattgcggatctg
acggaacgcgagaagctgaaacgcccgatcaaagcggtcgtggcatgtggtaacggcaca
gcaggtgcattcgcacctcgtattcttgaagcgctgggtgtggatgttattccactggac
tgcgagctggatcataccttcccgaactacaacccgaatccggaagatatgaagatgctt
catgcgatccgcgacaaggtgctggaaaccggcgctgaagttggtctgggctttgacggt
gatggtgaccgctgcggtgtggttgataacgaaggtgaagagatcttcgcagataaagtc
ggcgtcatgctcgcccgcgatatctccgcgttacatccggaaactcagttcgttgtggat
gtgaagtcaaccggtctctaccacacggacccggtcctcaaggccaatggtgcgaagact
gactacttcaaaaccggtcactcttacatcaaacgccgcgtgactgagcttggtgcgatc
gctggcttcgaaaagtccggccactatttcttcaacccaccaattggccgtgggtatgat
gatggtgttgtctctgcagttgctgttctggacatgatggaccgcaacccggataagacc
atggctgatctgcgccgtgacctgccaaagacctggggctccccaaccatggcagcaaaa
tgcgcagatgagatcaagtacgatgtggttgatcgtgttgttgagcgcttcaagtctatg
aaggcggaaggcgcgaaagtatccggtcatgacattgatgacctcatcaccgtaaacggc
gttcgtgttgtttgtgatgacggcacctggggccttgttcgcgcatcctccaacaaacct
gaactggttgttgtggtggaaagcccagtttctgaagagcgcctgcacgagatgttcaaa
gcaatggattcagtcctgcgcgaaaatccagaggttggtgactacaaccagacacttgct
gaactggcctaa

DBGET integrated database retrieval system