KEGG   Pseudovibrio sp. FO-BEG1: PSE_2736Help
Entry
PSE_2736          CDS       T01669                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PSE_2736
   00240 Pyrimidine metabolism
    PSE_2736
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    PSE_2736
   03430 Mismatch repair
    PSE_2736
   03440 Homologous recombination
    PSE_2736
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     PSE_2736
DNA replication proteins [BR:psf03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     PSE_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2910422..2910550
Genome map
AA seq 42 aa AA seqDB search
MFDGNDQEALQEARQRWMEVKNSDHELTYWAQTDNGGWDRKA
NT seq 129 nt NT seq  +upstreamnt  +downstreamnt
atgtttgacggcaacgatcaggaagcgctgcaggaagcccgccagcgctggatggaagtc
aagaacagcgaccacgaactcacttactgggcgcagaccgacaacggcgggtgggatcga
aaagcatga

DBGET integrated database retrieval system