KEGG   Pseudovibrio sp. FO-BEG1: PSE_2805Help
Entry
PSE_2805          CDS       T01669                                 

Gene name
melA
Definition
Alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Galactose metabolism
Glycerolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:psf00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:psf00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2984890..2986260
Genome map
AA seq 456 aa AA seqDB search
MARNPKITFVGAGSTTFMKNIIGDILQRPALSGAHVALMDINEERLGESEIVARKLIATL
GVSATVSTHTNQMEALDSADFVVVAFQIGGYEPCTVTDFEIPKKYDLRQTIADTLGIGGI
MRGLRTVPHLWSICEDMLKVCPEAVMLQYVNPMAINTWAIAQKYPQIKQVGLCHSVQGTV
KELAHDLDLDPANIRYRCAGINHMAFYLYLEEIKEDGTFEDLYPRLMEGYREGRYPKPST
WNPRCQNVVRYEMLTRLGHFVTESSEHFSEYVPWFIKRDRPDLLEKFSIPLDEYPVRCVE
QIERWKSQVEDYKNAESIEVERSQEYASTIMNSIWTGEPSVIYGNVQNKGYITSLPQDCA
VEVPCLVDRNGIQPTHISKLPAQLAALMRTNIGPQELTVEALMTENREHIYHAAMLDPHT
AAELDLEQIWAMVDELLEAHKDWLPAWTQKQVLETA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaaccccaaaattacctttgttggtgccggttcgaccaccttcatgaagaac
attatcggcgatattctgcagcgtcccgcgctgtctggagcacatgttgctctcatggat
atcaacgaagagcgccttggtgaatctgaaatcgttgcccgcaaactgattgcgaccctg
ggagtgagcgcaactgtttcaactcacaccaaccagatggaagcacttgattccgctgac
tttgttgtggtcgccttccagatcggcggctacgagccgtgcactgttaccgatttcgaa
attccgaagaagtacgacctgcgccaaaccatcgccgacaccctcggcatcggcggcatc
atgcgcggcctccgcaccgttccgcacctctggagcatctgcgaagatatgctcaaggtt
tgcccggaagcggtcatgctgcaatacgtgaacccaatggcgatcaacacttgggccatc
gcgcaaaagtacccacaaatcaaacaggtaggcctctgccactctgttcagggtacggtg
aaagaactggcccacgaccttgatctggatcctgcaaatatccgctacagatgtgcaggt
atcaatcacatggcgttctatctgtatctggaagagatcaaggaagacggcactttcgaa
gacctctacccacgtctgatggagggctatcgtgaaggccgttatccgaagccgtctacc
tggaatccacgctgtcagaacgtcgtgcgctacgaaatgctcacccgtcttggtcacttc
gtgactgaaagctcagagcatttttccgagtatgttccgtggtttatcaagcgcgaccgt
cctgatcttctggagaagttctccataccgcttgatgaatatccagtccgctgcgtcgag
cagatcgaacgctggaagtctcaggtggaagactacaagaacgccgagagtatcgaagtg
gagcgcagtcaagagtacgcttccacaatcatgaactccatctggactggcgaaccatcc
gtaatctacgggaacgtccagaacaaaggctacatcacctccctgccgcaggactgcgcg
gtggaagtgccttgcctcgttgatcgcaacggcattcagccaacgcatattagcaaactg
cctgcacagctggctgcacttatgcgcaccaatatcggcccgcaggagctgacagttgaa
gctctcatgaccgagaaccgtgagcatatctaccacgcagccatgttggatccgcacacc
gctgcggagctggatctggagcagatttgggcaatggtggacgagcttctggaagcgcac
aaggactggttgccagcatggacgcagaagcaagtgcttgaaacagcgtaa

DBGET integrated database retrieval system