KEGG   Pseudovibrio sp. FO-BEG1: PSE_2805Help
Entry
PSE_2805          CDS       T01669                                 

Gene name
melA
Definition
Alpha-galactosidase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PSE_2805 (melA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSE_2805 (melA)
   00600 Sphingolipid metabolism
    PSE_2805 (melA)
Enzymes [BR:psf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PSE_2805 (melA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2984890..2986260
Genome map
AA seq 456 aa AA seqDB search
MARNPKITFVGAGSTTFMKNIIGDILQRPALSGAHVALMDINEERLGESEIVARKLIATL
GVSATVSTHTNQMEALDSADFVVVAFQIGGYEPCTVTDFEIPKKYDLRQTIADTLGIGGI
MRGLRTVPHLWSICEDMLKVCPEAVMLQYVNPMAINTWAIAQKYPQIKQVGLCHSVQGTV
KELAHDLDLDPANIRYRCAGINHMAFYLYLEEIKEDGTFEDLYPRLMEGYREGRYPKPST
WNPRCQNVVRYEMLTRLGHFVTESSEHFSEYVPWFIKRDRPDLLEKFSIPLDEYPVRCVE
QIERWKSQVEDYKNAESIEVERSQEYASTIMNSIWTGEPSVIYGNVQNKGYITSLPQDCA
VEVPCLVDRNGIQPTHISKLPAQLAALMRTNIGPQELTVEALMTENREHIYHAAMLDPHT
AAELDLEQIWAMVDELLEAHKDWLPAWTQKQVLETA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggcccgaaaccccaaaattacctttgttggtgccggttcgaccaccttcatgaagaac
attatcggcgatattctgcagcgtcccgcgctgtctggagcacatgttgctctcatggat
atcaacgaagagcgccttggtgaatctgaaatcgttgcccgcaaactgattgcgaccctg
ggagtgagcgcaactgtttcaactcacaccaaccagatggaagcacttgattccgctgac
tttgttgtggtcgccttccagatcggcggctacgagccgtgcactgttaccgatttcgaa
attccgaagaagtacgacctgcgccaaaccatcgccgacaccctcggcatcggcggcatc
atgcgcggcctccgcaccgttccgcacctctggagcatctgcgaagatatgctcaaggtt
tgcccggaagcggtcatgctgcaatacgtgaacccaatggcgatcaacacttgggccatc
gcgcaaaagtacccacaaatcaaacaggtaggcctctgccactctgttcagggtacggtg
aaagaactggcccacgaccttgatctggatcctgcaaatatccgctacagatgtgcaggt
atcaatcacatggcgttctatctgtatctggaagagatcaaggaagacggcactttcgaa
gacctctacccacgtctgatggagggctatcgtgaaggccgttatccgaagccgtctacc
tggaatccacgctgtcagaacgtcgtgcgctacgaaatgctcacccgtcttggtcacttc
gtgactgaaagctcagagcatttttccgagtatgttccgtggtttatcaagcgcgaccgt
cctgatcttctggagaagttctccataccgcttgatgaatatccagtccgctgcgtcgag
cagatcgaacgctggaagtctcaggtggaagactacaagaacgccgagagtatcgaagtg
gagcgcagtcaagagtacgcttccacaatcatgaactccatctggactggcgaaccatcc
gtaatctacgggaacgtccagaacaaaggctacatcacctccctgccgcaggactgcgcg
gtggaagtgccttgcctcgttgatcgcaacggcattcagccaacgcatattagcaaactg
cctgcacagctggctgcacttatgcgcaccaatatcggcccgcaggagctgacagttgaa
gctctcatgaccgagaaccgtgagcatatctaccacgcagccatgttggatccgcacacc
gctgcggagctggatctggagcagatttgggcaatggtggacgagcttctggaagcgcac
aaggactggttgccagcatggacgcagaagcaagtgcttgaaacagcgtaa

DBGET integrated database retrieval system