KEGG   Pseudovibrio sp. FO-BEG1: PSE_2813Help
Entry
PSE_2813          CDS       T01669                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:psf00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:psf00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:psf02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2995738..2997234
Genome map
AA seq 498 aa AA seqDB search
MRVPLAAVLLTCSTALAWAEPDFPQKNNRWFEAAEAEIQSKLARQPITKPAKNIILMIAD
GNGIATNYATRIFQGQQNGLLGEENVLPQEAFPHSALVKTYNVNAQTPDSAGTGTAFHSG
VKTKSGVLGVDETVNFADCAAVEAGRVATIAEVLAAQGKAVGIITTASLTDATPASAYAH
VASRRYEDDASVPDGCDVPDIAVQLLKQIKNGTIDIAMGGGRRHMLPETATDKDSKDRNR
RDGRNLIDEAKEFGVTYVWDEKSFSELDPSAGKPVLGVFSSGHMDYDYDRKDQPSLAEMV
KLTIESLQDNENGFYMLVEGGRVDHANHAGNLFRALTDGVAFAEAVAMAEQMTSDQDTLI
IVTADHAHTLSFNGYCGRGSPINGLCMGIDNNGVKHTDEMLLGLDGKPFTVAGYLNGTGS
ILTEENNWFGTRPVVSQEEALDSEYKQQSLLPLDKETHAGTDVAVYAKGPWAHLFDGTIE
QNYIFNVMNYAANAKEEE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgccacttgctgcggtcctgttgacctgttctaccgctctggcttgggcagag
cctgattttcctcaaaaaaacaatcgatggttcgaggctgcggaagctgaaatccagagc
aaactggctcgacaacccatcacaaagcctgccaaaaacatcatcctgatgatcgcggat
ggcaatggcatcgcaaccaactacgccacacgcatctttcagggccagcaaaacggtttg
ctgggggaagaaaacgttctgcctcaggaagcctttcctcacagcgcattggtcaagacc
tacaacgtcaatgcgcaaacaccagattcagctggaacaggtactgctttccattcaggg
gtcaaaaccaaatctggtgtgctgggtgtcgatgagacggtgaacttcgccgattgcgcc
gcagtggaagcgggccgtgtcgcgaccattgctgaagttctggccgcccagggcaaggct
gttggcatcatcacaacggccagcctgaccgatgcaacaccagcttcagcttatgctcac
gttgcctcaaggcgttatgaggatgatgccagcgtgccggacggctgtgatgttcctgat
atcgctgtacagctgctgaagcagatcaaaaacggcaccatcgacatcgctatgggagga
gggcgccgccacatgctccctgaaacggcaacagacaaagacagcaaagatcgaaaccgc
agagatggccgcaatctcattgacgaagccaaagagtttggcgtcacctatgtgtgggat
gaaaagtctttcagcgaacttgatccatccgcgggcaagccggtgcttggtgttttcagt
tcaggtcacatggattacgactatgaccgaaaagaccagccatccctcgcagaaatggtg
aaactgaccattgaatcgctgcaggataatgaaaatggcttctatatgctggtggaagga
ggccgtgttgaccatgccaatcatgccggaaacctcttccgcgctttgactgatggcgtt
gcttttgctgaagcagtcgccatggcagagcagatgaccagtgatcaggacacgctgatt
atcgtgacagcagaccacgcccacacgctctctttcaatggctattgtggacgcggctca
cccatcaatggcctgtgcatgggcatcgacaacaacggcgtcaaacacactgatgaaatg
cttctgggactggatggcaagcccttcactgttgctggttatctgaacggcacaggctca
attctgacagaagaaaacaactggtttggcacacgtcctgtcgtctctcaggaagaagcg
ctggactcggagtacaagcaacaatcgctgcttccgctggacaaggaaacacatgctgga
acggatgttgctgtctatgccaaaggcccatgggcgcacctgtttgatggcacgattgag
cagaactacatcttcaacgtcatgaactacgccgccaacgccaaagaagaggaatga

DBGET integrated database retrieval system