KEGG   Pseudovibrio sp. FO-BEG1: PSE_2884Help
Entry
PSE_2884          CDS       T01669                                 

Gene name
rbsK
Definition
Ribokinase, bacterial
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSE_2884 (rbsK)
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PSE_2884 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3086165..3087088
Genome map
AA seq 307 aa AA seqDB search
MSIVIVGSINVDITTRSDRLPQPGETLHGHSYAINLGGKGCNQAVAVSKLGGGAQLVGRI
GNDGFGDIAARHLEDMGVSTEHVLTHEDHGTGIAVIGVDSNSENSITVIGGANLAIDESD
LKRTSDVLEHAQILLLQLEIPIEACLSAAKKVRASGGKVIFDPAPAPVNGLPEGFLQNVD
VVTPNETETEILTGFRPTNAEEAAHAANLLREQGVAAAVVKLGARGVYFKDETSEGFVEP
FKVNAIDTVAAGDCFNGGLAYALAGGKTLAEAVRFAAACGALSTTKHGAATSAPTLAEVE
ALMGSKG
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgtcattgtcggttccatcaatgttgatatcacaacccgttctgaccggctg
ccacagccgggtgaaacactgcatggacacagctacgccatcaatctgggtggcaaaggc
tgcaatcaggcagttgcggtttccaaactaggcggaggcgctcagttggtagggcgtatc
ggcaatgatggatttggagacattgccgctcggcatttggaagacatgggtgtttcaaca
gaacatgtgctcacccacgaagaccacggcactggtatcgctgtgatcggtgtcgattca
aactccgaaaacagtatcactgtgattggtggcgcaaacttggctatcgatgaaagtgac
ctgaaacgcacatcagatgttttggaacacgctcagattttgctcctgcaactggagatc
ccaattgaggcctgcctgagcgctgctaaaaaagtccgtgcctctggcggcaaagtgatc
tttgacccggcgcctgcacccgtcaatggcctgccggaaggcttcctgcaaaacgtggat
gttgtcacgccaaacgagactgaaaccgaaatcctcacaggcttccgcccaaccaacgca
gaagaagcagcccatgctgcgaacctgctgagagagcagggcgttgctgcggctgtcgtg
aaactgggtgcacgcggcgtctactttaaagatgagacaagtgaagggttcgtggaaccg
ttcaaggtgaacgcgatcgacacagtcgcagccggtgattgcttcaacggcggtctggcc
tatgcgctggctggtggtaaaactctggcagaagctgtccgcttcgcagctgcttgcggt
gcactttccaccaccaaacacggcgcagccacatctgcaccaacactggctgaagttgaa
gccctaatgggctctaaaggctga

DBGET integrated database retrieval system