KEGG   Pseudovibrio sp. FO-BEG1: PSE_2949Help
Entry
PSE_2949          CDS       T01669                                 

Definition
Ureohydrolase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSE_2949
Enzymes [BR:psf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PSE_2949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3176766..3177734
Genome map
AA seq 322 aa AA seqDB search
MSEHGYASGRLNLPFVGISTFGKKEYVWDWDAIDADVAVLGAPFDFGAQWRSGARFGPRA
VREASTLFSFGHAGAYDHEDDATYLGGDVRIVDIGDADIIHTKTEESHANIQVGVKKILD
AGALPVVIGGDHSINIPCIRAFEEDCAKNGPIHVIQIDAHLDFVDERHGVTEGHGNPMRR
AIEKDYVSGMTQLGIRNVSSTAKEGYDDARARGSDILSVRQVRELGTEAVLSRIPEGARY
YVTIDIDAFCPSIASGTGTPSHGGFQYYDVLEILQGLSKRGDVVGMDLVEVAPAYDPSDS
TQILAAQLLLNFIGFIFHNKKS
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaacatggatatgcgtccgggcgtttgaacctgccatttgtcggcatctcaacc
tttggcaaaaaagaatacgtatgggattgggatgccattgatgcagatgttgcagtcctg
ggcgcaccatttgatttcggtgcccagtggcgctccggtgctcgttttggcccacgtgct
gtccgcgaagcatccacgctgttttccttcggtcacgcgggggcttacgaccatgaggat
gatgcaacctatctgggcggggatgtccgtatcgttgacatcggagatgcagatatcatt
catacgaaaacggaggaaagccacgcaaacattcaggtgggcgtaaagaaaatcctggat
gccggcgcgctgcctgtggtgatcggtggtgatcactccatcaacatcccatgtattcgt
gcgtttgaggaagactgtgccaagaatggtccaatccacgtcattcagatcgatgcacat
ttggacttcgtggatgagcgccacggcgtgactgagggccacggcaacccgatgcgccgc
gcgattgagaaagactacgtttccggcatgacccagcttggtatccgcaacgtgtcctca
accgccaaagaaggctacgacgatgctcgcgcaagaggctctgacatcctgtccgtccgt
caggtgcgtgaactgggtacggaagctgtactcagccgcattccggaaggcgcacgttat
tacgtgaccattgatatcgacgctttctgcccatccatcgcatccggcaccggcacccca
agccatggcggcttccagtactacgatgttctggaaatcctgcagggcctcagcaaacgc
ggcgatgtggtcggtatggacctggtggaagtagccccagcatatgacccatctgattca
acccagatcctcgccgcccaactcctcctcaactttatcggcttcatcttccataacaag
aagagctga

DBGET integrated database retrieval system