KEGG   Pseudovibrio sp. FO-BEG1: PSE_3007Help
Entry
PSE_3007          CDS       T01669                                 

Definition
(GenBank) diguanylate cyclase (GGDEF domain)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
psf  Pseudovibrio sp. FO-BEG1
Brite
Enzymes [BR:psf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     PSE_3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3240280..3241338)
Genome map
AA seq 352 aa AA seqDB search
MSQEDEFKRTIVYADSALDYIKTNKLPAFPRNYELWYSYASGFNRALNRTINKILARDGK
ISPEETQKIYNRFLSPNRLGERIDEVGDKISEEVRELISALDKGTLKTTEYGEELARTLS
ALENVSDRSQLSKLVIHLAKLTTETAESNQELREQLVDSRRQIGVLQEGLEAIRYESLTD
ELTTLNNRKHFDQSLVRAVKEAEESHAPLSLLISDIDHFKQFNDNYGHQTGDQVLRLVAL
AVKQNVKNNDIACRYGGEEFGIILPRTTIEDAKVIAEKIRKNVVAKELVKRSTGENLGRI
TISIGISTFRPGDSAESMVSRADLALYAAKKAGRNLVKAEEEKKIPSVTQVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagacgagttcaagcgtactattgtttatgcagacagtgcgctcgattac
atcaaaacgaataagcttccagcgtttccacgcaactatgagctgtggtattcttacgca
tccggatttaaccgggctctcaaccggaccatcaataagattcttgcccgtgacggcaaa
atctctcctgaagaaactcagaagatctacaaccgttttttgtcgccaaaccgtttgggc
gaacgcattgacgaagttggcgacaagatctccgaggaagtccgggagctgatttctgct
cttgataaaggcacgctgaagaccaccgaatacggtgaagagcttgcccgcactttgagc
gctctggagaacgtgagtgatcgttctcaactttccaaacttgtgatccatcttgccaag
ctgaccactgaaactgctgaaagcaatcaggagcttcgcgaacagttggttgattctcgt
cgccagattggcgttctgcaagaaggtttggaagcgatccgttatgagtcgcttaccgat
gagttgaccacgctgaacaaccgcaagcacttcgatcaaagtctggtgcgcgcggtgaaa
gaagcggaagagagccatgcgcccctctccttgctgatttcagatatcgaccacttcaag
cagttcaacgacaactacggccaccagaccggtgaccaggttcttcgcctcgttgcactg
gctgtgaagcagaacgtgaaaaacaacgacatcgcatgtcgttacggcggtgaagagttt
ggcatcattctgccacgtaccaccattgaagatgcgaaagtgattgcggagaagatccgt
aagaacgttgttgcaaaggaactggtgaagcgctccacgggcgagaaccttggccgcatc
acgatctccatcggtatctccaccttccgtccgggcgacagtgcggagagcatggtttct
cgtgcagaccttgcgctttatgcagcgaagaaggctggccgcaacctggtgaaagctgag
gaagagaaaaaaatccccagcgtgacacaggttgcctga

DBGET integrated database retrieval system