KEGG   Pseudovibrio sp. FO-BEG1: PSE_3007Help
Entry
PSE_3007          CDS       T01669                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
psf  Pseudovibrio sp. FO-BEG1
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3240280..3241338)
Genome map
AA seq 352 aa AA seqDB search
MSQEDEFKRTIVYADSALDYIKTNKLPAFPRNYELWYSYASGFNRALNRTINKILARDGK
ISPEETQKIYNRFLSPNRLGERIDEVGDKISEEVRELISALDKGTLKTTEYGEELARTLS
ALENVSDRSQLSKLVIHLAKLTTETAESNQELREQLVDSRRQIGVLQEGLEAIRYESLTD
ELTTLNNRKHFDQSLVRAVKEAEESHAPLSLLISDIDHFKQFNDNYGHQTGDQVLRLVAL
AVKQNVKNNDIACRYGGEEFGIILPRTTIEDAKVIAEKIRKNVVAKELVKRSTGENLGRI
TISIGISTFRPGDSAESMVSRADLALYAAKKAGRNLVKAEEEKKIPSVTQVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagaagacgagttcaagcgtactattgtttatgcagacagtgcgctcgattac
atcaaaacgaataagcttccagcgtttccacgcaactatgagctgtggtattcttacgca
tccggatttaaccgggctctcaaccggaccatcaataagattcttgcccgtgacggcaaa
atctctcctgaagaaactcagaagatctacaaccgttttttgtcgccaaaccgtttgggc
gaacgcattgacgaagttggcgacaagatctccgaggaagtccgggagctgatttctgct
cttgataaaggcacgctgaagaccaccgaatacggtgaagagcttgcccgcactttgagc
gctctggagaacgtgagtgatcgttctcaactttccaaacttgtgatccatcttgccaag
ctgaccactgaaactgctgaaagcaatcaggagcttcgcgaacagttggttgattctcgt
cgccagattggcgttctgcaagaaggtttggaagcgatccgttatgagtcgcttaccgat
gagttgaccacgctgaacaaccgcaagcacttcgatcaaagtctggtgcgcgcggtgaaa
gaagcggaagagagccatgcgcccctctccttgctgatttcagatatcgaccacttcaag
cagttcaacgacaactacggccaccagaccggtgaccaggttcttcgcctcgttgcactg
gctgtgaagcagaacgtgaaaaacaacgacatcgcatgtcgttacggcggtgaagagttt
ggcatcattctgccacgtaccaccattgaagatgcgaaagtgattgcggagaagatccgt
aagaacgttgttgcaaaggaactggtgaagcgctccacgggcgagaaccttggccgcatc
acgatctccatcggtatctccaccttccgtccgggcgacagtgcggagagcatggtttct
cgtgcagaccttgcgctttatgcagcgaagaaggctggccgcaacctggtgaaagctgag
gaagagaaaaaaatccccagcgtgacacaggttgcctga

DBGET integrated database retrieval system