KEGG   Pseudovibrio sp. FO-BEG1: PSE_3138Help
Entry
PSE_3138          CDS       T01669                                 

Definition
putative agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    PSE_3138
Enzymes [BR:psf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     PSE_3138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3361748..3362608
Genome map
AA seq 286 aa AA seqDB search
MSVFLDSELTEAERKAEDVLFTIIPVPLERTVSYGSGTVKGPEAIIEASNELERGSNGVE
PCASGISTQEPVACDGPLPEVMERLAQRTEAAVKAGKIPVTLGGEHSLSYGAVSGVARAL
GKPVGIVQVDAHADLRIAYQGEKHSHASVMNLLMEEGNSLAQFGVRALCQQEMDSRSENK
VFFVDAEELVTKGLHAVDLPEDFPEDIYISFDVDGLDPSQMPATGTPVPGGLGYYQAIHL
VEHALKGRKCVGLDVVELAPDGNAAWDFTAAQITYRLMAAALKSRI
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttttctcgacagtgagctgactgaagcagaacgtaaggcagaagacgtgctc
ttcaccatcattccggtgcctctggagcgtaccgtttcttatggctctggcaccgtaaaa
gggccagaagccatcatcgaagcaagtaacgaactggagcgcggcagtaatggcgttgaa
ccatgcgcctccggcatttctacacaagagccggtagcgtgtgatggtcctctcccagag
gtaatggaacgtctagcacagcgcactgaagctgcagtcaaagctggcaagatcccggtc
acgctcggcggagagcattctctatcttatggcgctgtgtccggagtcgctcgcgcacta
ggtaagccagtaggaatcgtgcaggtagatgcacatgcagatctgcgcattgcctatcag
ggtgaaaagcactcccacgcctctgtcatgaaccttctgatggaagaggggaattctctc
gctcagttcggcgtgcgtgcactttgtcagcaggaaatggatagcagatcagaaaacaag
gtgttctttgtcgatgcggaagagctggtgaccaaaggcttgcatgctgttgatttgccg
gaagacttcccggaggacatctacatttcctttgatgtcgacggcctcgatccatcccag
atgccagccacaggcacgccggtaccaggtggccttggctattatcaagccattcatctg
gtggagcatgccctcaaaggccgcaagtgcgtcggtcttgatgtagttgaactagcccca
gatgggaatgccgcatgggatttcaccgccgctcagatcacataccgcctcatggctgca
gcgcttaagtcaagaatataa

DBGET integrated database retrieval system