KEGG   Pseudovibrio sp. FO-BEG1: PSE_3206Help
Entry
PSE_3206          CDS       T01669                                 

Definition
3(2),5 -bisphosphate nucleotidase, bacterial
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
psf  Pseudovibrio sp. FO-BEG1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:psf00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSE_3206
Enzymes [BR:psf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     PSE_3206
Transfer RNA biogenesis [BR:psf03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    PSE_3206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3439343..3440152)
Genome map
AA seq 269 aa AA seqDB search
MIEGFKLAALEAGQRILGIYEEGFQSETKGDGSPVTIADQQAEEIILNHLSTFCPDVPVI
AEEAMAAGIMPEIGSRFILVDPLDGTREFISRNGEFTVNIALIEDGTPTKGVIYAPVTGE
LFWGEVGHGAYRAEANGLELGEVTQMNCSAFSEKLRVLASRSHRSERTNAMLEKLDNSSI
VAAGSSLKFCRLAEGKADFYPRMEPTMEWDTAAGQAILCAAGGSVVVEGGGPLEYGKLKT
PQDKPFANPCFLAVADEKIISHYGLRSGW
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgattgaaggttttaagcttgcggcattagaagccgggcaacgaattctggggatttat
gaggaaggctttcagtctgagactaaaggtgatggatctcctgtcacgattgctgaccag
caagcggaagaaatcatcctcaatcacctttccacattttgcccggatgtacccgtgatt
gcggaagaggccatggctgcgggcatcatgccggaaatcggatcccgctttattcttgtt
gatccattggatggaacgcgcgagttcatcagccgcaatggcgagttcactgtcaatatt
gctcttattgaagatggaaccccaaccaaaggcgtcatttatgcacctgtgacgggagaa
ttgttctggggcgaagtcgggcatggtgcgtatcgcgcagaagccaatgggcttgaactt
ggtgaagtcacgcagatgaactgctcggcgttttctgaaaagttgcgtgtgcttgccagc
cggtctcatcgcagcgaacgcaccaatgccatgttagagaaactggacaactcttctatc
gtcgctgcagggtcttccttgaaattctgtcgtctggctgaaggaaaagctgacttttat
ccgcgtatggagccgacaatggagtgggatacggctgctggtcaggcgattctttgtgct
gctggtggctctgttgttgtggaaggtggtgggccacttgaatatggcaagctgaaaacg
cctcaggacaagcccttcgcaaatccgtgctttttagcggtcgcggacgaaaaaattatt
tcccattatggcttaaggtcgggttggtaa

DBGET integrated database retrieval system